You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Huntingtin antibody for Immunofluorescence

Recommended Huntingtin Antibody (supplied by: Log in to see )

Antigen
Huntingtin (HTT) Antibodies
  • HTT
  • hd
  • ZHD
  • CG9995
  • Dmel\\CG9995
  • HD
  • Hsap\\HD
  • Htt
  • dHtt
  • dhtt
  • SLC6A4
  • huntington
  • it15
  • htt
  • IT15
  • AI256365
  • C430023I11Rik
  • Hd
  • Hdh
  • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4
  • huntingtin
  • SLC6A4
  • LOC100216476
  • htt
  • Htt
  • HTT
  • HDH
Reactivity
Human
146
97
57
13
6
2
2
2
1
1
1
Host
Rabbit
79
72
3
1
Clonality
Polyclonal
Conjugate
This Huntingtin antibody is un-conjugated
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
128
71
71
37
25
23
21
15
13
8
3
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4320701
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.3205185 ABIN516386 IF ELISA Mouse IgG2b kappa AA 1524-1627, partial Log in to see 1D1
11.3205185 ABIN516387 IF ELISA WB Mouse IgG2b kappa AA 1524-1627, partial Log in to see 1C10
11.3205185 ABIN561241 IF ELISA WB Mouse IgG1 kappa AA 81-190, partial Log in to see 2E10
1 ABIN4320700 ELISA ICC IF IHC WB Rabbit C-Term Log in to see Polyclonal 3
1 ABIN4320702 ELISA IF IHC IHC (p) WB Mouse IgG Log in to see 3-19
1 ABIN4320699 ELISA ICC IF IHC WB Rabbit N-Term Log in to see Polyclonal
1 ABIN4320703 IF IHC IHC (p) WB Mouse IgG Log in to see 4-13
1 ABIN2741589 IF IHC WB Mouse IgG AA 544-552 Log in to see 4-13
1 ABIN2622231 IHC (fro) IF IHC (p) WB Goat IgG AA 85-200 Log in to see Polyclonal
1 ABIN2741590 ELISA IF IHC WB Mouse IgG Log in to see 3-19
1 ABIN2741593 ELISA IF IHC WB Rabbit IgG AA 544-562 Log in to see Polyclonal
1 ABIN2741594 IF IHC WB Rabbit IgG pSer421 Log in to see Polyclonal
1 ABIN2741595 IF IHC WB Rabbit IgG pSer434 Log in to see Polyclonal
1 ABIN4320704 ELISA ICC IF IHC (p) WB Mouse IgG1 Log in to see HU-2E8
1 ABIN2622232 ELISA IF IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2741592 ELISA IF IHC (fro) WB Rabbit IgG Log in to see Polyclonal
1 ABIN330990 IHC (fro) IF IP WB Mouse IgG1 AA 997-1276 Log in to see
1 ABIN1904136 IF IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2963087 IF IHC (p) ELISA WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2607207 DB ICC IF WB Mouse IgG2b Log in to see 2401C1a

Top referenced anti-Huntingtin antibody for Immunofluorescence

Similar anti-Huntingtin Antibodies

Application / Reactivity Human
Dot Blot (DB) 3 Antibodies
ELISA 69 Antibodies
Enzyme Immunoassay (EIA) 3 Antibodies
Fluorescence Microscopy (FM) 2 Antibodies
Immunochromatography (IC) 8 Antibodies
Immunocytochemistry (ICC) 14 Antibodies
Immunofluorescence (IF) 21 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 67 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 35 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 24 Antibodies
Immunoprecipitation (IP) 22 Antibodies
Western Blotting (WB) 119 Antibodies

General

Antigen Huntingtin (HTT) Antibodies
Reactivity Human
(146), (97), (57), (13), (6), (2), (2), (2), (1), (1), (1)
Host Rabbit
(79), (72), (3), (1)
Clonality
Polyclonal
Conjugate This Huntingtin antibody is un-conjugated
(2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(128), (71), (71), (37), (25), (23), (21), (15), (13), (8), (3), (3), (2), (1)
Supplier Log in to see

Product Details anti-Huntingtin Antibody

Target Details Huntingtin Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLD
Isotype IgG

Target Details Huntingtin

Product Details anti-Huntingtin Antibody Application Details Handling Images back to top
Antigen
Alternative Name Huntingtin (HTT Antibody Abstract)
Background Gene Symbol: HTT
Gene ID 3064
UniProt P42858
Research Area Neurology, Virology
Pathways PI3K-Akt Signaling, Hormone Transport, Transition Metal Ion Homeostasis, Tube Formation, Protein targeting to Nucleus

Application Details

Product Details anti-Huntingtin Antibody Target Details Huntingtin Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Huntingtin Antibody Target Details Huntingtin Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Huntingtin Antibody Target Details Huntingtin Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Huntingtin antibody (HTT) (ABIN4320701) Immunohistochemistry-Paraffin: Huntingtin Antibody [NBP1-89710] - Staining of human d...
Immunofluorescence (IF) image for anti-Huntingtin antibody (HTT) (ABIN4320701) Immunocytochemistry/Immunofluorescence: Huntingtin Antibody [NBP1-89710] Staining of ...