You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PDPK1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PDPK1 Antibody (supplied by: Log in to see )

Antigen
3-phosphoinositide Dependent Protein Kinase-1 (PDPK1) Antibodies
  • 1210
  • BG02759
  • CG1201
  • CG1210
  • DSTPK61
  • Dmel\\CG1210
  • Dstpk61
  • PDK
  • PDK-1
  • PDK1
  • PDK1/Pk61C
  • PK61C
  • Pk61C
  • Pk61C/PDK1
  • dPDK-1
  • dPDK1
  • dSTPK61
  • pk61c
  • pdpk1
  • MGC82080
  • zgc:153787
  • CD79B
  • LOC100304995
  • Pdk1
  • PDPK2
  • PRO0461
  • Phosphoinositide-dependent kinase 1
  • 3-phosphoinositide dependent protein kinase-1
  • 3-phosphoinositide dependent protein kinase-1a
  • CD79b molecule, immunoglobulin-associated beta
  • CD79b
  • 3-phosphoinositide-dependent protein kinase 1
  • 3-phosphoinositide dependent protein kinase 1
  • Protein PDK-1
  • Pdk1
  • pdpk1
  • pdpk1a
  • CD79B
  • CD79b
  • LOC100304995
  • Pdpk1
  • PDPK1
  • pdk-1
Reactivity
Human
431
186
180
10
10
8
7
6
4
1
1
1
1
1
1
1
1
Host
Rabbit
351
71
17
Clonality
Polyclonal
Conjugate
This PDPK1 antibody is un-conjugated
17
17
14
11
11
7
7
7
7
7
7
7
6
5
5
5
4
4
3
3
3
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
291
154
100
77
62
54
41
27
19
11
7
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344572
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.229836 ABIN954076 EIA IHC (p) WB Rabbit IgG Log in to see Polyclonal
11.229836 ABIN744668 IF (p) IHC (p) WB Rabbit IgG pSer241 Log in to see Polyclonal 1
11.229836 ABIN615271 IHC (p) WB Rabbit AA 269-320 Log in to see Polyclonal
11.229836 ABIN4344570 ICC IF IHC IHC (p) WB Rabbit pSer241 Log in to see Polyclonal
11.229836 ABIN214664 IHC (p) ELISA Rabbit pSer241 Log in to see Polyclonal
11.229836 ABIN4344574 ELISA FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 4A11
11.229836 ABIN4344641 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN196616 IF IHC (p) WB Rabbit pSer241 Log in to see Polyclonal 4
1 ABIN197100 IF IHC (p) WB Rabbit Ser241 Log in to see Polyclonal 5
1 ABIN127128 IHC (p) IP WB Rabbit Log in to see Polyclonal
1 ABIN3043600 IHC (p) WB Rabbit IgG AA 524-556, C-Term Log in to see Polyclonal
1 ABIN3044043 IHC (p) WB Rabbit IgG AA 408-421, C-Term Log in to see Polyclonal
1 ABIN303441 EIA IHC (p) Rabbit AA 236-248, pSer241 Log in to see Polyclonal
1 ABIN1108608 EIA FACS IF IHC (p) WB Mouse IgG1 Log in to see 4A11 3
1 ABIN2889054 IHC (p) ELISA WB Rabbit IgG AA 210-259 Log in to see Polyclonal
1 ABIN2888512 IHC (p) ELISA WB Rabbit IgG pSer241 Log in to see Polyclonal
1 ABIN373781 IHC (p) Rabbit Log in to see Polyclonal
1 ABIN962046 IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN682948 IF (p) IHC (p) WB Rabbit IgG pTyr373, pTyr376 Log in to see Polyclonal
1 ABIN744677 IHC (p) WB HRP Rabbit IgG pSer241 Log in to see Polyclonal

Top referenced anti-PDPK1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PDPK1 Antibodies

Application / Reactivity Human
Dot Blot (DB) 11 Antibodies
ELISA 150 Antibodies
ELISA (Capture) 2 Antibodies
Enzyme Immunoassay (EIA) 7 Antibodies
Flow Cytometry (FACS) 27 Antibodies
Immunocytochemistry (ICC) 41 Antibodies
Immunofluorescence (IF) 62 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 77 Antibodies
Immunohistochemistry (IHC) 100 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 55 Antibodies
Immunoprecipitation (IP) 18 Antibodies
Intracellular Staining (ICS) 3 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 285 Antibodies

General

Antigen 3-phosphoinositide Dependent Protein Kinase-1 (PDPK1) Antibodies
Reactivity Human
(431), (186), (180), (10), (10), (8), (7), (6), (4), (1), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(351), (71), (17)
Clonality
Polyclonal
Conjugate This PDPK1 antibody is un-conjugated
(17), (17), (14), (11), (11), (7), (7), (7), (7), (7), (7), (7), (6), (5), (5), (5), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(291), (154), (100), (77), (62), (54), (41), (27), (19), (11), (7), (3), (2), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PDPK1 Antibody

Target Details PDPK1 Application Details Handling References for anti-PDPK1 Antibody (ABIN4344572) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND
Isotype IgG

Target Details PDPK1

Product Details anti-PDPK1 Antibody Application Details Handling References for anti-PDPK1 Antibody (ABIN4344572) Images back to top
Antigen
Alternative Name PDK-1 (PDPK1 Antibody Abstract)
Background Gene Symbol: PDK1
Molecular Weight Theoretical MW: 49 kDa
Gene ID 5163
UniProt Q15118
Pathways PI3K-Akt Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-PDPK1 Antibody Target Details PDPK1 Handling References for anti-PDPK1 Antibody (ABIN4344572) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PDPK1 Antibody Target Details PDPK1 Application Details References for anti-PDPK1 Antibody (ABIN4344572) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PDPK1 Antibody (ABIN4344572)

Product Details anti-PDPK1 Antibody Target Details PDPK1 Application Details Handling Images back to top
Product cited in:

Fack, Espedal, Keunen, Golebiewska, Obad, Harter, Mittelbronn, Bähr, Weyerbrock, Stuhr, Miletic, Sakariassen, Stieber, Rygh, Lund-Johansen, Zheng, Gottlieb, Niclou, Bjerkvig: "Bevacizumab treatment induces metabolic adaptation toward anaerobic metabolism in glioblastomas." in: Acta neuropathologica, Vol. 129, Issue 1, pp. 115-31, 2015 (Sample species: Human). Further details: Western Blotting

Images

Product Details anti-PDPK1 Antibody Target Details PDPK1 Application Details Handling References for anti-PDPK1 Antibody (ABIN4344572) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PDPK1 antibody (3-phosphoinositide Dependent Protein Kinase-1) (ABIN4344572) Immunohistochemistry-Paraffin: PDK-1 Antibody [NBP1-85955] - Staining of human kidney...
Western Blotting (WB) image for anti-PDPK1 antibody (3-phosphoinositide Dependent Protein Kinase-1) (ABIN4344572) Western Blot: PDK-1 Antibody [NBP1-85955] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...