anti-Human PFKFB2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PFKFB2 Antibody (supplied by: Log in to see )

Antigen
6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2 (PFKFB2) Antibodies
  • pfkfb2
  • zgc:56282
  • PFK-2/FBPase-2
  • 4930568D07Rik
  • RH2K
  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2a
  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
  • pfkfb2a
  • PFKFB2
  • pfkfb2
  • Pfkfb2
Reactivity
Human
92
53
40
9
8
6
4
3
3
2
1
1
1
1
1
Host
Rabbit
85
8
3
Clonality
Polyclonal
Conjugate
This PFKFB2 antibody is un-conjugated
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
73
39
29
18
13
4
3
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344995
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN360654 EIA IHC (p) WB Rabbit Ig N-Term Log in to see Polyclonal 2
1 ABIN272060 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN392769 IHC (p) WB Rabbit Ig AA 1-30, N-Term Log in to see Polyclonal 3
1 ABIN962679 IHC (p) ELISA Goat AA 7-19 Log in to see Polyclonal
1 ABIN408068 IHC (p) IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1738023 IHC (p) ELISA Goat N-Term Log in to see Polyclonal
1 ABIN708260 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN708253 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN708251 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN2891814 IHC (p) WB Rabbit Pro479 Log in to see Polyclonal
1 ABIN2893708 IHC (p) WB Rabbit Tyr14 Log in to see Polyclonal
1 ABIN2884217 ELISA IHC (p) WB Rabbit IgG pSer483 Log in to see Polyclonal
1 ABIN2743606 ICC IF IHC (p) WB Rabbit N-Term Log in to see Polyclonal
1 ABIN4344997 IHC IHC (p) WB Alexa Fluor 488 Rabbit Log in to see Polyclonal
1 ABIN5585559 ELISA IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN4344996 IHC IHC (p) WB Alexa Fluor 647 Rabbit Log in to see Polyclonal
1 ABIN1805382 IHC (p) WB Rabbit AA 1-30 Log in to see Polyclonal
1 ABIN2771571 IHC (p) IHC ELISA Goat N-Term Log in to see Polyclonal

Top referenced anti-PFKFB2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PFKFB2 Antibodies

Application / Reactivity Human
ELISA 39 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 4 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 30 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 19 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Western Blotting (WB) 69 Antibodies

General

Antigen 6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2 (PFKFB2) Antibodies
Reactivity Human
(92), (53), (40), (9), (8), (6), (4), (3), (3), (2), (1), (1), (1), (1), (1)
Host Rabbit
(85), (8), (3)
Clonality
Polyclonal
Conjugate This PFKFB2 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(73), (39), (29), (18), (13), (4), (3), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-PFKFB2 Antibody

Target Details PFKFB2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG
Isotype IgG

Target Details PFKFB2

Product Details anti-PFKFB2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name PFKFB2 (PFKFB2 Antibody Abstract)
Background Gene Symbol: PFKFB2
Gene ID 5208
UniProt O60825
Research Area Metabolism, Cancer
Pathways PI3K-Akt Signaling, Positive Regulation of Peptide Hormone Secretion, Regulation of Carbohydrate Metabolic Process

Application Details

Product Details anti-PFKFB2 Antibody Target Details PFKFB2 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PFKFB2 Antibody Target Details PFKFB2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PFKFB2 Antibody Target Details PFKFB2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-PFKFB2 antibody (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2) (ABIN4344995) Immunohistochemistry: PFKFB2 Antibody [NBP2-33584] - Immunohistochemical staining of ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PFKFB2 antibody (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2) (ABIN4344995) Immunohistochemistry-Paraffin: PFKFB2 Antibody [NBP2-33584] - liver
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PFKFB2 antibody (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2) (ABIN4344995) Immunohistochemistry-Paraffin: PFKFB2 Antibody [NBP2-33584] - liver cancer
Immunofluorescence (IF) image for anti-PFKFB2 antibody (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2) (ABIN4344995) Immunocytochemistry/Immunofluorescence: PFKFB2 Antibody [NBP2-33584] - Staining of hu...