You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PFKFB2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PFKFB2 Antibody (supplied by: Log in to see )

6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2 (PFKFB2) Antibodies
  • 4930568D07Rik
  • PFK-2/FBPase-2
  • pfkfb2
  • RH2K
  • zgc:56282
This PFKFB2 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344995
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.00089864735 ABIN360654 EIA IHC (p) WB Rabbit Ig N-Term Log in to see Polyclonal 2
0.00089864735 ABIN272060 IHC (p) WB Rabbit Log in to see Polyclonal
0.00089864735 ABIN392769 IHC (p) WB Rabbit Ig AA 1-30, N-Term Log in to see Polyclonal 3
0.00089864735 ABIN962679 IHC (p) ELISA Goat N-Term Log in to see Polyclonal
0.00089864735 ABIN1738023 IHC (p) ELISA Goat N-Term Log in to see Polyclonal
0.00089864735 ABIN408068 IHC (p) IHC WB Rabbit IgG Log in to see Polyclonal
0.00089864735 ABIN1805382 IHC (p) WB Rabbit N-Term Log in to see Polyclonal
0.00089864735 ABIN708260 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
0.00089864735 ABIN708253 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
0.00089864735 ABIN708251 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
0.00089864735 ABIN4344996 IHC IHC (p) WB Alexa Fluor 647 Rabbit Log in to see Polyclonal
0.00089864735 ABIN2771571 IHC (p) IHC ELISA Goat N-Term Log in to see Polyclonal

Top referenced anti-PFKFB2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PFKFB2 Antibodies

Application / Reactivity Human
ELISA 40 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 3 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 12 Antibodies
Immunohistochemistry (IHC) 33 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Western Blotting (WB) 64 Antibodies


Antigen 6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2 (PFKFB2) Antibodies
Reactivity Human
(88), (46), (31), (7), (5), (2), (1)
Host Rabbit
(83), (8), (3)
Conjugate This PFKFB2 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(70), (40), (32), (12), (12), (4), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-PFKFB2 Antibody

Target Details PFKFB2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG
Isotype IgG

Target Details PFKFB2

Product Details anti-PFKFB2 Antibody Application Details Handling Images back to top
Alternative Name PFKFB2 (PFKFB2 Antibody Abstract)
Background Gene Symbol: PFKFB2
UniProt O60825
Research Area Metabolism, Cancer
Pathways PI3K-Akt Signaling

Application Details

Product Details anti-PFKFB2 Antibody Target Details PFKFB2 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PFKFB2 Antibody Target Details PFKFB2 Application Details Images back to top
Format Liquid
Buffer PBS and 40 % glycerol ( pH 7.2)
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-PFKFB2 Antibody Target Details PFKFB2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-PFKFB2 antibody (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2) (ABIN4344995) Immunohistochemistry: PFKFB2 Antibody [NBP2-33584] - Immunohistochemical staining of ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PFKFB2 antibody (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2) (ABIN4344995) Immunohistochemistry-Paraffin: PFKFB2 Antibody [NBP2-33584] - liver
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PFKFB2 antibody (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2) (ABIN4344995) Immunohistochemistry-Paraffin: PFKFB2 Antibody [NBP2-33584] - liver cancer
Immunofluorescence (IF) image for anti-PFKFB2 antibody (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 2) (ABIN4344995) Immunocytochemistry/Immunofluorescence: PFKFB2 Antibody [NBP2-33584] - Staining of hu...