You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PHLPP1 antibody for Immunohistochemistry

Recommended PHLPP1 Antibody (supplied by: Log in to see )

PH Domain and Leucine Rich Repeat Protein Phosphatase 1 (PHLPP1) Antibodies
  • SCOP
  • AI836256
  • Phlpp
  • Plekhe1
  • mKIAA0606
  • Scop
  • PH domain and leucine rich repeat protein phosphatase 1
  • PHLPP1
  • phlpp1
  • Phlpp1
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4345254
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.50061 ABIN2430635 IHC ELISA Rabbit IgG Log in to see Polyclonal
8.50061 ABIN2423971 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN3060632 ICC IF IP IHC WB Rabbit Log in to see Polyclonal

Similar anti-PHLPP1 Antibodies

Application / Reactivity Human
ELISA 10 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 4 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunohistochemistry (IHC) 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 6 Antibodies
Immunoprecipitation (IP) 9 Antibodies
Western Blotting (WB) 30 Antibodies


Antigen PH Domain and Leucine Rich Repeat Protein Phosphatase 1 (PHLPP1) Antibodies
Reactivity Human
(37), (10), (6)
Host Rabbit
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(30), (10), (9), (5), (4), (3), (2), (2), (1)
Supplier Log in to see

Product Details anti-PHLPP1 Antibody

Target Details PHLPP1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ
Isotype IgG

Target Details PHLPP1

Product Details anti-PHLPP1 Antibody Application Details Handling Images back to top
Alternative Name PHLPP (PHLPP1 Antibody Abstract)
Background Gene Symbol: PHLPP1
Gene ID 23239
UniProt O60346
Research Area Apoptosis/Necrosis, Cancer
Pathways PI3K-Akt Signaling, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-PHLPP1 Antibody Target Details PHLPP1 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PHLPP1 Antibody Target Details PHLPP1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-PHLPP1 Antibody Target Details PHLPP1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-PHLPP1 antibody (PH Domain and Leucine Rich Repeat Protein Phosphatase 1) (ABIN4345254) Immunohistochemistry: PHLPP Antibody [NBP2-33887] - liver
Immunohistochemistry (IHC) image for anti-PHLPP1 antibody (PH Domain and Leucine Rich Repeat Protein Phosphatase 1) (ABIN4345254) Immunohistochemistry: PHLPP Antibody [NBP2-33887] - Immunohistochemical staining of h...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PHLPP1 antibody (PH Domain and Leucine Rich Repeat Protein Phosphatase 1) (ABIN4345254) Immunohistochemistry-Paraffin: PHLPP Antibody [NBP2-33887] - liver cancer