anti-Mouse (Murine) Protein Phosphatase 2, Regulatory Subunit B', gamma antibody for Immunohistochemistry

Recommended Protein Phosphatase 2, Regulatory Subunit B', gamma Antibody (supplied by: Log in to see )

Antigen
Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) Antibodies
  • b56g
  • ppp2r5c
  • si:dkey-241l7.9
  • 2610043M05Rik
  • 2700063L20Rik
  • AI060890
  • AW545884
  • C85228
  • D12Bwg0916e
  • mKIAA0044
  • B56G
  • PR61G
  • protein phosphatase 2, regulatory subunit B', gamma
  • protein phosphatase 2, regulatory subunit B', gamma b
  • protein phosphatase 2, regulatory subunit B (B56), gamma isoform
  • ppp2r5c
  • PPP2R5C
  • ppp2r5cb
  • Ppp2r5c
Reactivity
Human, Mouse (Murine), Rat (Rattus)
70
40
25
6
3
3
3
3
2
2
2
2
2
2
1
1
Host
Rabbit
45
24
1
Clonality
Polyclonal
Conjugate
Un-conjugated
5
4
4
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
56
16
13
9
3
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347114
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1876668 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2887404 IHC WB Rabbit Log in to see Polyclonal
1 ABIN3048393 IHC WB Rabbit Log in to see Polyclonal

Similar anti-Protein Phosphatase 2, Regulatory Subunit B', gamma Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
Immunocytochemistry (ICC) 1 Antibodies 1 Antibodies 1 Antibodies
Immunofluorescence (IF) 1 Antibodies 1 Antibodies 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies 13 Antibodies 13 Antibodies
Immunohistochemistry (IHC) 4 Antibodies 4 Antibodies 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4 Antibodies 4 Antibodies 4 Antibodies
Western Blotting (WB) 14 Antibodies 29 Antibodies
Immunoprecipitation (IP) 2 Antibodies
ELISA 16 Antibodies

General

Antigen Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(70), (40), (25), (6), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1)
Host Rabbit
(45), (24), (1)
Clonality
Polyclonal
Conjugate Un-conjugated
(5), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(56), (16), (13), (9), (3), (3), (1)
Supplier Log in to see

Product details

Target details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQKDPKKDRPLARRKSELPQDPHTKKALEAHC
Isotype IgG

Target details

Product details Application Details Handling Images back to top
Antigen
Alternative Name PPP2R5C (PPP2CA Antibody Abstract)
Background Gene Symbol: PPP2R5C
Gene ID 5527
Research Area Signaling
Pathways PI3K-Akt Signaling

Application Details

Product details Target details Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) antibody (ABIN4347114) Western Blot: PPP2R5C Antibody [NBP1-88961] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) antibody (ABIN4347114) Immunohistochemistry-Paraffin: PPP2R5C Antibody [NBP1-88961] - Staining of human cere...
Immunofluorescence (IF) image for anti-Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) antibody (ABIN4347114) Immunocytochemistry/Immunofluorescence: PPP2R5C Antibody [NBP1-88961] - Staining of h...