You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PPP2R2B antibody for Immunohistochemistry

Recommended PPP2R2B Antibody (supplied by: Log in to see )

Protein Phosphatase 2, Regulatory Subunit B, beta (PPP2R2B) Antibodies
  • ppp2r2b
  • ppp2r2b-a
  • ppp2r2c
  • zgc:101861
  • PPP2R2B
  • 2900026H06Rik
  • 6330404L05Rik
  • E130009M08Rik
  • PP2A-PR55B
  • PR55-BETA
  • SCA12
  • B55BETA
  • PP2APR55B
  • PR52B
  • PR55BETA
  • Pppr2b2
  • PP2A
  • protein phosphatase 2, regulatory subunit B, beta
  • protein phosphatase 2, regulatory subunit B, alpha
  • protein phosphatase 2, regulatory subunit B, beta b
  • protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform
  • PPP2R2B
  • ppp2r2a
  • ppp2r2b
  • ppp2r2bb
  • Ppp2r2b
Human, Mouse (Murine), Rat (Rattus)
This PPP2R2B antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347091
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.71222 ABIN2495606 FACS IF IHC ELISA WB Rabbit Ig Fraction Center Log in to see Polyclonal
1 ABIN442987 IHC (p) IHC WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN4347090 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN4904839 FACS IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2471594 IP IHC ELISA WB Mouse IgG2a kappa Log in to see 1F3
1 ABIN2687004 IHC ELISA WB Rabbit AA 164-308 Log in to see Polyclonal
1 ABIN2770679 IP IHC (p) IHC ELISA WB Mouse IgG2a, kappa Log in to see 1F3
1 ABIN2793450 FACS IHC WB Rabbit Ig Fraction Center Log in to see Polyclonal
1 ABIN1855790 IHC ELISA WB Rabbit Log in to see Polyclonal

Similar anti-PPP2R2B Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 5 Antibodies 5 Antibodies 34 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 1 Antibodies 2 Antibodies
Immunofluorescence (IF) 1 Antibodies 1 Antibodies
Immunohistochemistry (IHC) 1 Antibodies 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies 2 Antibodies
Immunoprecipitation (IP) 2 Antibodies 2 Antibodies
Western Blotting (WB) 10 Antibodies 11 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 6 Antibodies


Antigen Protein Phosphatase 2, Regulatory Subunit B, beta (PPP2R2B) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(51), (11), (10), (2), (1), (1), (1), (1), (1)
Host Rabbit
(39), (12)
Conjugate This PPP2R2B antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(46), (34), (10), (9), (9), (6), (5), (2), (2)
Supplier Log in to see

Product Details anti-PPP2R2B Antibody

Target Details PPP2R2B Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
Isotype IgG

Target Details PPP2R2B

Product Details anti-PPP2R2B Antibody Application Details Handling Images back to top
Alternative Name PPP2R2B (PPP2R2B Antibody Abstract)
Background Gene Symbol: PPP2R2B
Gene ID 5521
UniProt Q00005
Research Area Neurology
Pathways PI3K-Akt Signaling, Mitotic G1-G1/S Phases

Application Details

Product Details anti-PPP2R2B Antibody Target Details PPP2R2B Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PPP2R2B Antibody Target Details PPP2R2B Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-PPP2R2B Antibody Target Details PPP2R2B Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: Marker [kDa] 250, 130, 95, 72, ...
Immunohistochemistry (IHC) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Immunohistochemistry: PPP2R2B Antibody [NBP2-46667] - Analysis of human cerebral cort...
Western Blotting (WB) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Immunohistochemistry (IHC) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Immunohistochemistry: PPP2R2B Antibody [NBP2-46667] - Analysis of human liver tissue.
Immunohistochemistry (IHC) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Immunohistochemistry: PPP2R2B Antibody [NBP2-46667] - Analysis of human liver cancer.