You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) PPP2R3A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PPP2R3A Antibody (supplied by: Log in to see )

Antigen
Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) Antibodies
  • PP2A B''-PR59
  • PP2A PR59
  • PR59
  • Ppp2r3
  • Ppp2r3a
  • PPP2R3
  • PR130
  • PR72
  • 3222402P14Rik
  • A730042E07
  • PPP2R3A
  • protein phosphatase 2, regulatory subunit B'', alpha
  • protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha
  • protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha
  • protein phosphatase 2 (formerly 2A), regulatory subunit B'', delta
  • serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like
  • PPP2R3A
  • ppp2r3a
  • Ppp2r3d
  • Ppp2r3a
  • LOC787607
Reactivity
Human, Mouse (Murine), Rat (Rattus)
74
36
35
2
2
2
2
1
1
1
Host
Rabbit
45
30
Clonality
Polyclonal
Conjugate
This PPP2R3A antibody is un-conjugated
4
4
4
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
30
26
25
16
12
3
3
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347100
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN714326 IF (p) IHC (p) WB Rabbit IgG AA 830-880 Log in to see Polyclonal
1 ABIN714335 IHC (p) WB HRP Rabbit IgG AA 830-880 Log in to see Polyclonal
1 ABIN714328 IHC (p) WB Biotin Rabbit IgG AA 830-880 Log in to see Polyclonal
1 ABIN912010 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN912005 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN873063 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-PPP2R3A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PPP2R3A Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 4 Antibodies 5 Antibodies 30 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 1 Antibodies 4 Antibodies
Immunofluorescence (IF) 1 Antibodies 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 26 Antibodies 26 Antibodies
Immunohistochemistry (IHC) 4 Antibodies 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7 Antibodies 8 Antibodies
Western Blotting (WB) 11 Antibodies 12 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies

General

Antigen Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(74), (36), (35), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(45), (30)
Clonality
Polyclonal
Conjugate This PPP2R3A antibody is un-conjugated
(4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(30), (26), (25), (16), (12), (3), (3), (2)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PPP2R3A Antibody

Target Details PPP2R3A Application Details Handling References for anti-PPP2R3A Antibody (ABIN4347100) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE
Isotype IgG

Target Details PPP2R3A

Product Details anti-PPP2R3A Antibody Application Details Handling References for anti-PPP2R3A Antibody (ABIN4347100) Images back to top
Antigen
Alternative Name PPP2R3A (PPP2R3A Antibody Abstract)
Background Gene Symbol: PPP2R3A
Gene ID 5523
Research Area Kinases/Phosphatases, Cell Cycle, Cancer
Pathways PI3K-Akt Signaling

Application Details

Product Details anti-PPP2R3A Antibody Target Details PPP2R3A Handling References for anti-PPP2R3A Antibody (ABIN4347100) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PPP2R3A Antibody Target Details PPP2R3A Application Details References for anti-PPP2R3A Antibody (ABIN4347100) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PPP2R3A Antibody (ABIN4347100)

Product Details anti-PPP2R3A Antibody Target Details PPP2R3A Application Details Handling Images back to top
Product cited in:

DeGrande, Little, Nixon, Wright, Snyder, Dun, Murphy, Kilic, Higgins, Binkley, Boyden, Carnes, Anderson, Hund, Mohler: "Molecular mechanisms underlying cardiac protein phosphatase 2A regulation in heart." in: The Journal of biological chemistry, Vol. 288, Issue 2, pp. 1032-46, 2013

Images

Product Details anti-PPP2R3A Antibody Target Details PPP2R3A Application Details Handling References for anti-PPP2R3A Antibody (ABIN4347100) back to top
Supplier Images
Western Blotting (WB) image for anti-PPP2R3A antibody (Protein Phosphatase 2, Regulatory Subunit B'', alpha) (ABIN4347100) Western Blot: PPP2R3A Antibody [NBP1-87233] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Western Blotting (WB) image for anti-PPP2R3A antibody (Protein Phosphatase 2, Regulatory Subunit B'', alpha) (ABIN4347100) Western Blot: PPP2R3A Antibody [NBP1-87233] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PPP2R3A antibody (Protein Phosphatase 2, Regulatory Subunit B'', alpha) (ABIN4347100) Immunohistochemistry-Paraffin: PPP2R3A Antibody [NBP1-87233] - Staining of human hipp...
Immunofluorescence (IF) image for anti-PPP2R3A antibody (Protein Phosphatase 2, Regulatory Subunit B'', alpha) (ABIN4347100) Immunocytochemistry/Immunofluorescence: PPP2R3A Antibody [NBP1-87233] - Staining of h...