anti-Human PPP2R4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PPP2R4 Antibody (supplied by: Log in to see )

Antigen
Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) Antibodies
  • 6330556D22Rik
  • PP2A
  • PR65
  • PR53
  • PTPA
  • PTPRA
  • 2610042B21Rik
  • C77440
  • N28142
  • protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform
  • protein phosphatase 2A activator, regulatory subunit 4
  • protein phosphatase 2A, regulatory subunit B (PR 53)
  • Ppp2r1a
  • PPP2R4
  • Ppp2r4
Reactivity
Human, Mouse (Murine), Rat (Rattus)
80
36
31
6
5
3
3
2
2
2
2
2
1
1
Host
Rabbit
39
34
11
Clonality
Polyclonal
Conjugate
This PPP2R4 antibody is un-conjugated
4
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
75
38
37
27
23
22
8
4
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347105
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1108715 EIA FACS IF IHC (p) WB Mouse IgG1 Log in to see 4D9 2
1 ABIN1804475 IHC (p) ELISA WB Goat AA 347-358 Log in to see Polyclonal
1 ABIN1500384 ELISA FACS ICC IF IHC (p) WB Mouse IgG1 Log in to see 4D9
1 ABIN2627099 IHC (p) WB Rabbit AA 271-320 Log in to see Polyclonal
1 ABIN3032389 IHC (p) WB Rabbit IgG AA 1-309 Log in to see Polyclonal
1 ABIN5586075 ELISA FACS IF IHC (p) WB Mouse IgG1 Log in to see 4D9
1 ABIN2149482 IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1689924 ICC IHC (p) WB Rabbit Log in to see Polyclonal

General

Antigen Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(80), (36), (31), (6), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1)
Host Rabbit
(39), (34), (11)
Clonality
Polyclonal
Conjugate This PPP2R4 antibody is un-conjugated
(4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(75), (38), (37), (27), (23), (22), (8), (4), (3), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-PPP2R4 Antibody

Target Details PPP2R4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKF
Isotype IgG

Target Details PPP2R4

Product Details anti-PPP2R4 Antibody Application Details Handling Images back to top
Antigen
Alternative Name PPP2R4 (PPP2R4 Antibody Abstract)
Background Gene Symbol: PPP2R4
Gene ID 5524
Research Area Signaling
Pathways PI3K-Akt Signaling, M Phase, Hepatitis C, Toll-Like Receptors Cascades

Application Details

Product Details anti-PPP2R4 Antibody Target Details PPP2R4 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PPP2R4 Antibody Target Details PPP2R4 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PPP2R4 Antibody Target Details PPP2R4 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) antibody (ABIN4347105) Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human stoma...
Western Blotting (WB) image for anti-Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) antibody (ABIN4347105) Western Blot: PPP2R4 Antibody [NBP1-87232] - Lane 1: Marker [kDa] 220, 112, 84, 47, 3...
Immunofluorescence (IF) image for anti-Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) antibody (ABIN4347105) Immunocytochemistry/Immunofluorescence: PPP2R4 Antibody [NBP1-87232] - Staining of hu...
Western Blotting (WB) image for anti-Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) antibody (ABIN4347105) Western Blot: PPP2R4 Antibody [NBP1-87232] - Lane 1: NIH-3T3 cell lysate (Mouse embry...
Immunofluorescence (IF) image for anti-Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) antibody (ABIN4347105) Immunocytochemistry/Immunofluorescence: PPP2R4 Antibody - Staining of human cell lin...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) antibody (ABIN4347105) Immunohistochemistry-Paraffin: PPP2R4 Antibody - Staining of human kidney shows mode...