You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PPP2R4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PPP2R4 Antibody (supplied by: Log in to see )

Antigen
Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) Antibodies
  • 2610042B21Rik
  • 6330556D22Rik
  • C77440
  • N28142
  • PP2A
  • PR53
  • PR65
  • PTPA
  • PTPRA
Reactivity
Human, Mouse (Murine), Rat (Rattus)
61
29
26
4
4
2
2
1
1
1
1
Host
Rabbit
40
16
10
Clonality
Polyclonal
Conjugate
This PPP2R4 antibody is un-conjugated
3
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
59
23
21
14
11
8
7
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347105
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.00089185475 ABIN1108715 EIA FACS IF IHC (p) WB Mouse IgG1 Log in to see 4D9 2
0.00089185475 ABIN1804475 IHC (p) ELISA WB Goat Log in to see Polyclonal
0.00089185475 ABIN2627099 IHC (p) Rabbit AA 271-320 Log in to see Polyclonal
0.00089185475 ABIN2495623 IHC (p) WB Rabbit IgG AA 6-20, N-Term Log in to see Polyclonal
0.00089185475 ABIN3032389 IHC (p) WB Rabbit IgG AA 1-309 Log in to see Polyclonal
0.00089185475 ABIN2149482 IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal
0.00089185475 ABIN1689924 ICC IHC (p) WB Rabbit Log in to see Polyclonal

Top referenced anti-PPP2R4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PPP2R4 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
Chromatin Immunoprecipitation (ChIP) 2 Antibodies 2 Antibodies
ELISA 9 Antibodies 8 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies 4 Antibodies
Immunofluorescence (IF) 4 Antibodies 4 Antibodies
Immunohistochemistry (IHC) 8 Antibodies 8 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4 Antibodies 3 Antibodies
Immunoprecipitation (IP) 3 Antibodies 3 Antibodies
Western Blotting (WB) 23 Antibodies

General

Antigen Protein Phosphatase 2A Activator, Regulatory Subunit 4 (PPP2R4) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(61), (29), (26), (4), (4), (2), (2), (1), (1), (1), (1)
Host Rabbit
(40), (16), (10)
Clonality
Polyclonal
Conjugate This PPP2R4 antibody is un-conjugated
(3), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(59), (23), (21), (14), (11), (8), (7), (3), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-PPP2R4 Antibody

Target Details PPP2R4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKF
Isotype IgG

Target Details PPP2R4

Product Details anti-PPP2R4 Antibody Application Details Handling Images back to top
Antigen
Alternative Name PPP2R4 (PPP2R4 Antibody Abstract)
Background Gene Symbol: PPP2R4
Research Area Signaling
Pathways PI3K-Akt Signaling

Application Details

Product Details anti-PPP2R4 Antibody Target Details PPP2R4 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PPP2R4 Antibody Target Details PPP2R4 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PPP2R4 Antibody Target Details PPP2R4 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PPP2R4 antibody (Protein Phosphatase 2A Activator, Regulatory Subunit 4) (ABIN4347105) Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human stoma...
Western Blotting (WB) image for anti-PPP2R4 antibody (Protein Phosphatase 2A Activator, Regulatory Subunit 4) (ABIN4347105) Western Blot: PPP2R4 Antibody [NBP1-87232] - Lane 1: Marker [kDa] 220, 112, 84, 47, 3...
Immunofluorescence (IF) image for anti-PPP2R4 antibody (Protein Phosphatase 2A Activator, Regulatory Subunit 4) (ABIN4347105) Immunocytochemistry/Immunofluorescence: PPP2R4 Antibody [NBP1-87232] - Staining of hu...
Western Blotting (WB) image for anti-PPP2R4 antibody (Protein Phosphatase 2A Activator, Regulatory Subunit 4) (ABIN4347105) Western Blot: PPP2R4 Antibody [NBP1-87232] - Lane 1: NIH-3T3 cell lysate (Mouse embry...