60 kDa Heat Shock Protein (Mitochondrial) protein (GST tag)

Details for Product No. ABIN1046435
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Protein Name
Protein Characteristics
Mitochondrial
Origin
Human
(2)
Source
Escherichia coli (E. coli)
(2)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 2 references available
Catalog no. ABIN1046435
Quantity 200 µg
Price
687.50 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGE
Characteristics Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix.
Purity 90%
Background Synonyms: 60 kDa chaperonin,Chaperonin 60,CPN60,Heat shock protein 60,HSP-60,Hsp60,HuCHA60,Mitochondrial matrix protein P1,P60 lymphocyte protein
Molecular Weight 86 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Venner, Singh, Gupta: "Nucleotide sequences and novel structural features of human and Chinese hamster hsp60 (chaperonin) gene families." in: DNA and cell biology, Vol. 9, Issue 8, pp. 545-52, 1991 (PubMed).

Jindal, Dudani, Singh et al.: "Primary structure of a human mitochondrial protein homologous to the bacterial and plant chaperonins and to the 65-kilodalton mycobacterial antigen." in: Molecular and cellular biology, Vol. 9, Issue 5, pp. 2279-83, 1989 (PubMed).

Hosts (2)
Reactivities (2)
back to top