Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1046692

Chemokine (C-C Motif) Ligand 5 (CCL5) protein (GST tag)

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP, Scya5, MuRantes, Rantes
Origin
»Alternatives Human
Source
»Alternatives Escherichia coli (E. coli)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 2 references available
Catalog no. ABIN1046692
Quantity 10 µg
Price
327.80 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 9 to 11 Business Days
Sequence SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVV FVTRKNRQVCANPEKKWVREYINSLEMS
Characteristics Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.
Purity 90%
Alternative Name C-C motif chemokine 5
Background Synonyms: EoCP,Eosinophil chemotactic cytokine,SIS-delta,Small-inducible cytokine A5,T cell-specific protein P228,TCP228,T-cell-specific protein RANTES
Molecular Weight 34 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Schall, Jongstra, Dyer et al.: "A human T cell-specific molecule is a member of a new gene family." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 141, Issue 3, pp. 1018-25, 1988 (PubMed).

Nomiyama, Fukuda, Iio et al.: "Organization of the chemokine gene cluster on human chromosome 17q11.2 containing the genes for CC chemokine MPIF-1, HCC-2, HCC-1, LEC, and RANTES." in: Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research, Vol. 19, Issue 3, pp. 227-34, 1999 (PubMed).

Alternatives for antigen "Chemokine (C-C Motif) Ligand 5 (CCL5)", type "Proteins"
Hosts (73), (9)
Reactivities (53), (16), (15), (3), (3), (1), (1), (1), (1)
Beacon