COMM Domain Containing 4 (COMMD4) protein (GST tag)

Details for Product No. ABIN1046847
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Protein Name
Synonyms 1110039H05Rik, zgc:153556
Origin
Human
(8), (1), (1)
Source
Escherichia coli (E. coli)
(5), (3), (2)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 2 references available
Catalog no. ABIN1046847
Quantity 200 µg
Price
687.50 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKE LLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAA KHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKH LRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLE VAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM
Characteristics Down-regulates activation of NF-kappa-B. Ref.1
Purity 90%
Alternative Name COMM domain-containing protein 4
Molecular Weight 48 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer 6M guanidine hydrochloride, 20mM Tris
Storage -20 °C
Product cited in: Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs...." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Burstein, Hoberg, Wilkinson et al.: "COMMD proteins, a novel family of structural and functional homologs of MURR1." in: The Journal of biological chemistry, Vol. 280, Issue 23, pp. 22222-32, 2005 (PubMed).

Hosts (5), (3), (2)
Reactivities (8), (1), (1)
back to top