Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1046851

COMM Domain Containing 4 (COMMD4) protein (GST tag)

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms 1110039H05Rik, zgc:153556
Origin
»Alternatives Human
Source
»Alternatives Escherichia coli (E. coli)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Catalog no. ABIN1046851
Quantity 200 µg
Price
687.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 9 to 11 Business Days
Sequence MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKE LLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAA KHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKH LRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLE VAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM
Characteristics Down-regulates activation of NF-kappa-B. Ref.1
Purity 90%
Alternative Name COMM domain-containing protein 4
Molecular Weight 45 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Burstein, Hoberg, Wilkinson et al.: "COMMD proteins, a novel family of structural and functional homologs of MURR1." in: The Journal of biological chemistry, Vol. 280, Issue 23, pp. 22222-32, 2005 (PubMed).

Alternatives for antigen "COMM Domain Containing 4 (COMMD4)", type "Proteins"
Hosts (7), (3)
Reactivities (10), (1), (1)
Beacon