Cyclin-Dependent Kinase 11A Protein A (AA 5-216), (partial) protein (GST tag)

Details for Product No. ABIN1046882
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Protein Name
Protein Characteristics
AA 5-216, partial
Origin
Human
(3)
Source
Escherichia coli (E. coli)
(3)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 4 references available
Catalog no. ABIN1046882
Quantity 1 mg
Price
1,842.50 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence KDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSK RDSLEEGELRDHCMEITIRNSPYRREDSMEDRGEEDDSLA IKPPQQMSRKEKVHHRKDEKRKEKCRHHSHSAEGGKHARV KEREHERRKRHREEQDKARREWERQKRREMAREHSRRERD RLEQLERKRERERKMREQQKEQREQKERERRAEERRKERE ARREVSAHHRTM
Characteristics Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression.
Purity 90%
Background Synonyms: Cell division cycle 2-like protein kinase 2,Cell division protein kinase 11A,Galactosyltransferase-associated protein kinase p58/GTA,PITSLRE serine/threonine-protein kinase CDC2L2
Molecular Weight 54.1 kD
UniProt Q9UQ88
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Xiang, Lahti, Grenet et al.: "Molecular cloning and expression of alternatively spliced PITSLRE protein kinase isoforms." in: The Journal of biological chemistry, Vol. 269, Issue 22, pp. 15786-94, 1994 (PubMed).

Gururajan, Lahti, Grenet et al.: "Duplication of a genomic region containing the Cdc2L1-2 and MMP21-22 genes on human chromosome 1p36.3 and their linkage to D1Z2." in: Genome research, Vol. 8, Issue 9, pp. 929-39, 1998 (PubMed).

Hu, Mayeda, Trembley et al.: "CDK11 complexes promote pre-mRNA splicing." in: The Journal of biological chemistry, Vol. 278, Issue 10, pp. 8623-9, 2003 (PubMed).

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Hosts (3)
Reactivities (3)
back to top