You are viewing an incomplete version of our website. Please click to reload the website as full version.

KIAA0494 (KIAA0494) (AA 1-483), (partial) protein (GST tag)

Details for Product No. ABIN1046958, Supplier: Log in to see
Protein Name
  • MGC80252
  • KIAA0494
  • DKFZp468F099
  • RP11-8J9.3
  • 4732418C07Rik
  • KIAA0494
  • hypothetical LOC100130197
  • EF-hand calcium binding domain 14
  • kiaa0494
  • LOC100130197
  • KIAA0494
  • EFCAB14
  • Efcab14
Protein Characteristics
AA 1-483, partial
2
1
1
1
1
Origin
Human
5
1
Source
Escherichia coli (E. coli)
2
2
1
1
Protein Type
Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Sequence MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTEPPDSD SESSSEEEEEFGVVGNRSRFAKGDYLRCCKICYPLCGFVI LAACVVACVGLVWMQVALKEDLDALKEKFRTMESNQKSSF QEIPKLNEELLSKQKQLEKIESGEMGLNKVWINITEMNKQ ISLLTSAVNHLKANVKSAADLISLPTTVEGLQKSVASIGN TLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPG SNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSA LVGYQRQNDLKLEGMNETVSNLTQRVNLIESDVVAMSKVE KKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKE DSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVES FTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQ DLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDG DGR
Characteristics calcium ion binding
Purity 90 %
Molecular Weight 81 kD
UniProt O75071
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Format Lyophilized
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Background publications Daub, Olsen, Bairlein, Gnad, Oppermann, Körner, Greff, Kéri, Stemmann, Mann: "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." in: Molecular cell, Vol. 31, Issue 3, pp. 438-48, 2008 (PubMed).

Product cited in: Gerhard, Wagner, Feingold, Shenmen, Grouse, Schuler, Klein, Old, Rasooly, Good, Guyer, Peck, Derge, Lipman, Collins, Jang, Sherry, Feolo, Misquitta, Lee, Rotmistrovsky, Greenhut, Schaefer, Buetow et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). ..." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Seki, Ohira, Nagase, Ishikawa, Miyajima, Nakajima, Nomura, Ohara: "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 4, Issue 5, pp. 345-9, 1998 (PubMed).