You are viewing an incomplete version of our website. Please click to reload the website as full version.

KIAA0494 (KIAA0494) (AA 1-483), (partial) protein (GST tag)

Details for Product No. ABIN1046958, Supplier: Log in to see
Protein Name
Protein Characteristics
AA 1-483, partial
2
1
1
1
1
Origin
Human
5
1
Source
Escherichia coli (E. coli)
4
1
1
Protein Type
Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Showcase your results, aid the scientific community, and receive a full refund.

Contribute a validation

Learn more

Sequence MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTEPPDSD SESSSEEEEEFGVVGNRSRFAKGDYLRCCKICYPLCGFVI LAACVVACVGLVWMQVALKEDLDALKEKFRTMESNQKSSF QEIPKLNEELLSKQKQLEKIESGEMGLNKVWINITEMNKQ ISLLTSAVNHLKANVKSAADLISLPTTVEGLQKSVASIGN TLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPG SNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSA LVGYQRQNDLKLEGMNETVSNLTQRVNLIESDVVAMSKVE KKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKE DSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVES FTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQ DLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDG DGR
Characteristics calcium ion binding
Purity 90 %
Molecular Weight 81 kD
UniProt O75071
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Format Lyophilized
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). ..." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Seki, Ohira, Nagase et al.: "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 4, Issue 5, pp. 345-9, 1998 (PubMed).

Background publications Daub, Olsen, Bairlein et al.: "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." in: Molecular cell, Vol. 31, Issue 3, pp. 438-48, 2008 (PubMed).