KIAA0494 Protein (AA 1-483, partial) (GST tag)
(3 references)-
- Target See all KIAA0494 (EFCAB14) Proteins
- KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))
- Protein Type
- Recombinant
- Protein Characteristics
- AA 1-483, partial
-
Origin
- Human
-
Source
- Escherichia coli (E. coli)
- Purification tag / Conjugate
- This KIAA0494 protein is labelled with GST tag.
- Application
- SDS-PAGE (SDS), ELISA
- Sequence
- MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTEPPDSD SESSSEEEEEFGVVGNRSRFAKGDYLRCCKICYPLCGFVI LAACVVACVGLVWMQVALKEDLDALKEKFRTMESNQKSSF QEIPKLNEELLSKQKQLEKIESGEMGLNKVWINITEMNKQ ISLLTSAVNHLKANVKSAADLISLPTTVEGLQKSVASIGN TLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPG SNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSA LVGYQRQNDLKLEGMNETVSNLTQRVNLIESDVVAMSKVE KKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKE DSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVES FTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQ DLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDG DGR
- Characteristics
- calcium ion binding
- Purity
- 90 %
- Top Product
- Discover our top product EFCAB14 Protein
-
EF-hand calcium binding domain 14 (EFCAB14) (AA 1-495) protein (GST tag)
EFCAB14 Origin: Human Host: Wheat germ Recombinant ELISA, WB, AP, AA
EF-hand calcium binding domain 14 (EFCAB14) (AA 1-495) protein (Strep Tag)Crystallography grade EFCAB14 Origin: Human Host: Tobacco (Nicotiana tabacum) Recombinant >80 % as determined by SDS PAGE, Size Exclusion Chromatography and Western Blot. SDS, ELISA, WB
EF-hand calcium binding domain 14 (EFCAB14) (AA 1-484) protein (Strep Tag)Crystallography grade EFCAB14 Origin: Mouse Host: Tobacco (Nicotiana tabacum) Recombinant ≥ 80 % as determined by SDS PAGE, Size Exclusion Chromatography and Western Blot. SDS, ELISA, WB
EF-hand calcium binding domain 14 (EFCAB14) protein (Myc-DYKDDDDK Tag)EFCAB14 Origin: Human Host: HEK-293 Cells Recombinant > 80 % as determined by SDS-PAGE and Coomassie blue staining AbP, STD
-
- Comment
-
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Buffer
- PBS buffer, 20mM GSH
- Storage
- -20 °C
-
-
: "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." in: Molecular cell, Vol. 31, Issue 3, pp. 438-48, (2008) (PubMed).
: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). ..." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, (2004) (PubMed).
: "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 4, Issue 5, pp. 345-9, (1998) (PubMed).
-
: "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." in: Molecular cell, Vol. 31, Issue 3, pp. 438-48, (2008) (PubMed).
-
- Target
- KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))
- Alternative Name
- EF-hand domain-containing protein KIAA0494 (EFCAB14 Products)
- Synonyms
- KIAA0494 Protein, RP11-8J9.3 Protein, 4732418C07Rik Protein, MGC80252 Protein, DKFZp468F099 Protein, RGD1310351 Protein, EF-hand calcium binding domain 14 Protein, EF-hand calcium binding domain 14 S homeolog Protein, EFCAB14 Protein, Efcab14 Protein, efcab14.S Protein, efcab14 Protein
- Molecular Weight
- 81 kD
- UniProt
- O75071
-
