Enolase 2 (Gamma, Neuronal) (ENO2) protein (GST tag)

Details for Product No. ABIN1047052
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Protein Name
Synonyms NSE, Eno-2, AI837106, D6Ertd375e, RNEN3, eno3, wu:fc09h05, zgc:92418, ENO2, DKFZp459B1817
Origin
Human
(33), (4), (3), (1), (1), (1), (1), (1), (1), (1)
Source
Escherichia coli (E. coli)
(24), (9), (6)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Catalog no. ABIN1047052
Quantity 50 µg
Price
217.80 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence SIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGAST GIYEALELRDGDKQRYLGKGVLKAVDHINSTIAPALISSG LSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKA GAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGN KLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYG KDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKIV IGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQ DFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLT VTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQ ENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNP
Characteristics Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival
Purity 90%
Alternative Name Gamma-enolase
Background Synonyms: 2-phospho-D-glycerate hydro-lyase,Enolase 2,Neural enolase,Neuron-specific enolase,NSE
Molecular Weight 74 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: McAleese, Dunbar, Fothergill et al.: "Complete amino acid sequence of the neurone-specific gamma isozyme of enolase (NSE) from human brain and comparison with the non-neuronal alpha form (NNE)." in: European journal of biochemistry / FEBS, Vol. 178, Issue 2, pp. 413-7, 1989 (PubMed).

Van Obberghen, Kamholz, Bishop et al.: "Human gamma enolase: isolation of a cDNA clone and expression in normal and tumor tissues of human origin." in: Journal of neuroscience research, Vol. 19, Issue 4, pp. 450-6, 1988 (PubMed).

Ansari-Lari, Shen, Muzny et al.: "Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination." in: Genome research, Vol. 7, Issue 3, pp. 268-80, 1997 (PubMed).

Hosts (24), (9), (6)
Reactivities (33), (4), (3), (1), (1), (1), (1), (1), (1), (1)
back to top