LIM and SH3 Protein 1 (LASP1) (AA 1-243), (partial) protein (GST tag)

Details for Product No. ABIN1047338
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms MLN50, Lasp-1, Def-4, SH3P6, AA408629, Tg(Col1a1-lacZ)1Ngma, fb92f05, zgc:77542, wu:fb92f05, LASP1, DKFZp459O1227, lasp1, MGC53336, MGC89667, mln50, lasp-1
Protein Characteristics
AA 1-243, partial
Origin
Human
(7), (1), (1), (1)
Source
Escherichia coli (E. coli)
(5), (3), (2)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 5 references available
Catalog no. ABIN1047338
Quantity 1 mg
Price
1,842.50 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLN MKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSEL QSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI KYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQ PHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAP GGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWM YGT
Characteristics Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types By similarity.
Purity 90%
Alternative Name LIM and SH3 domain protein 1
Background Synonyms: Metastatic lymph node gene 50 protein,MLN 50
Molecular Weight 55.2 kD
UniProt Q14847
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Tomasetto, Régnier, Moog-Lutz et al.: "Identification of four novel human genes amplified and overexpressed in breast carcinoma and localized to the q11-q21.3 region of chromosome 17." in: Genomics, Vol. 28, Issue 3, pp. 367-76, 1996 (PubMed).

Tomasetto, Moog-Lutz, Régnier et al.: "Lasp-1 (MLN 50) defines a new LIM protein subfamily characterized by the association of LIM and SH3 domains." in: FEBS letters, Vol. 373, Issue 3, pp. 245-9, 1995 (PubMed).

Gevaert, Goethals, Martens et al.: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." in: Nature biotechnology, Vol. 21, Issue 5, pp. 566-9, 2003 (PubMed).

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Tao, Wollscheid, OBrien et al.: "Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry." in: Nature methods, Vol. 2, Issue 8, pp. 591-8, 2005 (PubMed).

Hosts (5), (3), (2)
Reactivities (7), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top