Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1047338

LIM and SH3 Protein 1 (LASP1) protein (GST tag)

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms MLN50, Lasp-1, Def-4, SH3P6, AA408629, Tg(Col1a1-lacZ)1Ngma, fb92f05, zgc:77542, wu:fb92f05, LASP1, DKFZp459O1227, lasp1, MGC53336, MGC89667, mln50, lasp-1
Origin
»Alternatives Human
Source
»Alternatives Escherichia coli (E. coli)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 5 references available
Catalog no. ABIN1047338
Quantity 1 mg
Price
1,842.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 9 to 11 Business Days
Sequence MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLN MKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSEL QSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI KYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQ PHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAP GGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWM YGT
Characteristics Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types By similarity.
Purity 90%
Alternative Name LIM and SH3 domain protein 1
Background Synonyms: Metastatic lymph node gene 50 protein,MLN 50
Molecular Weight 53 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Tomasetto, Régnier, Moog-Lutz et al.: "Identification of four novel human genes amplified and overexpressed in breast carcinoma and localized to the q11-q21.3 region of chromosome 17." in: Genomics, Vol. 28, Issue 3, pp. 367-76, 1996 (PubMed).

Tomasetto, Moog-Lutz, Régnier et al.: "Lasp-1 (MLN 50) defines a new LIM protein subfamily characterized by the association of LIM and SH3 domains." in: FEBS letters, Vol. 373, Issue 3, pp. 245-9, 1995 (PubMed).

Gevaert, Goethals, Martens et al.: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." in: Nature biotechnology, Vol. 21, Issue 5, pp. 566-9, 2003 (PubMed).

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Tao, Wollscheid, OBrien et al.: "Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry." in: Nature methods, Vol. 2, Issue 8, pp. 591-8, 2005 (PubMed).

Alternatives for antigen "LIM and SH3 Protein 1 (LASP1)", type "Proteins"
Hosts (6), (4)
Reactivities (8), (1), (1), (1), (1)
Beacon