Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1047445

Non-Muscle Myosin Heavy Polypeptide 9 (MYH9) protein (GST tag)

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms
BDPLT6, DFNA17, EPSTS, FTNS, MHA, NMHC-II-A, NMMHC-IIA, NMMHCA, fi22c04, myh9, myh9l2, wu:fi22c04, wu:fj85e11, zgc:162029, zgc:66164, NMMHC, myosin, non-muscle, nonmuscle, KLG/PTK7, dfna17, epsts, ftn ... show more
Origin
»Alternatives Human
Source
»Alternatives Escherichia coli (E. coli)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Catalog no. ABIN1047445
Quantity 200 µg
Price
687.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 9 to 11 Business Days
Sequence AQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGF EPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFS KVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVI NPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSM MQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSK KDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRI
Characteristics Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.
Purity 90%
Alternative Name Myosin-9
Background Synonyms: Cellular myosin heavy chain, type A,Myosin heavy chain 9,Myosin heavy chain, non-muscle IIa,Non-muscle myosin heavy chain A,NMMHC-A,Non-muscle myosin heavy chain IIa,NMMHC II-a,NMMHC-IIA
Molecular Weight 53 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer 6M guanidine hydrochloride, 20mM Tris
Storage -20 °C
Product cited in: Simons, Wang, McBride et al.: "Human nonmuscle myosin heavy chains are encoded by two genes located on different chromosomes." in: Circulation research, Vol. 69, Issue 2, pp. 530-9, 1991 (PubMed).

Dunham, Shimizu, Roe et al.: "The DNA sequence of human chromosome 22." in: Nature, Vol. 402, Issue 6761, pp. 489-95, 1999 (PubMed).

Bechtel, Rosenfelder, Duda et al.: "The full-ORF clone resource of the German cDNA Consortium." in: BMC genomics, Vol. 8, pp. 399, 2008 (PubMed).

Alternatives for antigen "Non-Muscle Myosin Heavy Polypeptide 9 (MYH9)", type "Proteins"
Hosts (4), (3)
Reactivities (13), (1), (1), (1)
Beacon