Did you know that you can buy products from over 140 different suppliers from us?

Non-Muscle Myosin Heavy Polypeptide 9 (MYH9) (AA 2-241), (partial) protein (GST tag)

Details for Product No. ABIN1047449
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Protein Characteristics
AA 2-241, partial
Origin
Human
(12)
Source
Escherichia coli (E. coli)
(5), (3)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Quantity 10 µg
Options
Shipping to United States (Change)
Availability Discontinued
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1047449
327.80 $
Plus shipping costs $45.00
Add to Basket

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence AQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGF EPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFS KVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVI NPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSM MQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSK KDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRI
Characteristics Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.
Purity 90 %
Alternative Name Myosin-9
Background Synonyms: Cellular myosin heavy chain, type A,Myosin heavy chain 9,Myosin heavy chain, non-muscle IIa,Non-muscle myosin heavy chain A,NMMHC-A,Non-muscle myosin heavy chain IIa,NMMHC II-a,NMMHC-IIA
Molecular Weight 54.6 kD
UniProt P35579
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer 6M guanidine hydrochloride, 20mM Tris
Storage -20 °C
Product cited in: Simons, Wang, McBride et al.: "Human nonmuscle myosin heavy chains are encoded by two genes located on different chromosomes." in: Circulation research, Vol. 69, Issue 2, pp. 530-9, 1991 (PubMed).

Dunham, Shimizu, Roe et al.: "The DNA sequence of human chromosome 22. ..." in: Nature, Vol. 402, Issue 6761, pp. 489-95, 1999 (PubMed).

Bechtel, Rosenfelder, Duda et al.: "The full-ORF clone resource of the German cDNA Consortium." in: BMC genomics, Vol. 8, pp. 399, 2008 (PubMed).

Validation Images
back to top