Did you know that you can buy products from over 140 different suppliers from us?

Retinol Binding Protein 4, Plasma (RBP4) (AA 19-201), (full length) protein (His tag)

Details for Product No. ABIN1047602
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms rbp4, MGC54038, srbp, 2310002G05Rik, 2610028L19Rik, HSRBP4, RBP4, RBP, RNBP, RDCCAS, Rbp-4, RBPA, PRBP
Protein Characteristics
AA 19-201, full length
Origin
Human
(49), (11), (8), (4), (4), (4), (3), (1), (1)
Source
Escherichia coli (E. coli)
(48), (12), (7), (5), (4)
Protein Type Recombinant
Purification tag / Conjugate
His tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 4 references available
Quantity 1 mg
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1047602
1,317.80 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDN IVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDT EDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSC RLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELC LARQYRLIVHNGYCDGRSERNLL
Characteristics Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli.
Purity 90 %
Alternative Name Retinol-binding protein 4
Background Synonyms: Plasma retinol-binding protein
Molecular Weight 25.2 kD
UniProt P02753
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer
Storage -20 °C
Product cited in: DOnofrio, Colantuoni, Cortese: "Structure and cell-specific expression of a cloned human retinol binding protein gene: the 5'-flanking region contains hepatoma specific transcriptional signals." in: The EMBO journal, Vol. 4, Issue 8, pp. 1981-9, 1986 (PubMed).

Colantuoni, Romano, Bensi et al.: "Cloning and sequencing of a full length cDNA coding for human retinol-binding protein." in: Nucleic acids research, Vol. 11, Issue 22, pp. 7769-76, 1984 (PubMed).

Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Validation Images
back to top