Tumor Necrosis Factor (Ligand) Superfamily, Member 14 (TNFSF14) (AA 1-239), (partial) protein (GST tag)

Details for Product No. ABIN1047821
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms LTg, TR2, CD258, HVEML, LIGHT, HVEM-L, Ly113, TNFSF14
Protein Characteristics
AA 1-239, partial
Origin
Human
(15), (4), (1)
Source
Escherichia coli (E. coli)
(10), (7), (2), (1)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 2 references available
Catalog no. ABIN1047821
Quantity 10 µg
Price
327.80 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Discontinued
Add to Basket

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGL GLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSW EQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLAS TITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDS SFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM
Characteristics Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB, stimulates the proliferation of T-cells, and inhibits growth of the adenocarcinoma HT-29. Acts as a receptor for Herpes simplex virus.
Purity 90%
Alternative Name Tumor necrosis factor ligand superfamily member 14
Background Synonyms: Herpes virus entry mediator ligand,HVEM-L,Herpesvirus entry mediator ligand,CD258
Molecular Weight 53.6 kD
UniProt O43557
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer 6M guanidine hydrochloride, 20mM Tris
Storage -20 °C
Product cited in: Mauri, Ebner, Montgomery et al.: "LIGHT, a new member of the TNF superfamily, and lymphotoxin alpha are ligands for herpesvirus entry mediator." in: Immunity, Vol. 8, Issue 1, pp. 21-30, 1998 (PubMed).

Harrop, McDonnell, Brigham-Burke et al.: "Herpesvirus entry mediator ligand (HVEM-L), a novel ligand for HVEM/TR2, stimulates proliferation of T cells and inhibits HT29 cell growth." in: The Journal of biological chemistry, Vol. 273, Issue 42, pp. 27548-56, 1998 (PubMed).

Hosts (10), (7), (2), (1)
Reactivities (15), (4), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Add to Basket

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top