Vesicular, Overexpressed in Cancer, Prosurvival Protein 1 (VOPP1) protein (GST tag)

Details for Product No. ABIN1047917
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms ECOP, GASP, Ecop, AW146242, RGD1306494, ecop, gasp
Origin
Human
(9), (1), (1)
Source
Escherichia coli (E. coli)
(5), (3)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 1 reference available
Catalog no. ABIN1047917
Quantity 10 µg
Price
327.80 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Discontinued
Add to Basket

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence KKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWY FWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTR QPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPP NSPQGSVACPPPPAYCNTPPPPYEQVVKAK-
Characteristics Increases the transcriptional activity of NFKB1 by facilitating its nuclear translocation, DNA-binding and associated apoptotic response, when overexpressed.
Purity 90%
Alternative Name Vesicular, overexpressed in cancer, prosurvival protein 1
Background Synonyms: EGFR-coamplified and overexpressed protein,ECop,Glioblastoma-amplified secreted protein,Putative NF-kappa-B-activating protein 055N
Molecular Weight 44 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer 6M guanidine hydrochloride, 20mM Tris
Storage -20 °C
Product cited in: Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs...." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Hosts (5), (3)
Reactivities (9), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Add to Basket

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top