Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

sRANK Ligand Active (Receptor activator of nuclear factor kappa-B ligand) (AA 70 – 244) protein (His tag)

Name

sRANK Ligand Active (Receptor activator of nuclear factor kappa-B ligand)

Binding Site

AA 70 – 244

Protein Type

Recombinant

Host
Origin (Gene)
Alternatives

Human

Conjugate
His tag
Application
Cell Culture (CC), Western Blotting (WB), Immunogen (Imm)
5 references available
Catalog no. ABIN1112025
Quantity 10 μg
Price 145.20 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 6 to 7 Business Days

Additional Information

Sequence HHHHHHHHHHEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Format Lyophilized
Reconstitution Lyophilized protein should be reconstituted in water following instructions of batch Quality Control sheet. At higher concentrations the solubility may be reduced and multimers generated. Optimal concentration should be determined for specific application and cell lines.
Endotoxin Level < 0.04 EU / µg protein (LAL method)
Description Recombinant human RANKL is a member of TNF super family, a cytokine that play a central role in bone remodelling and disorders of mineral metabolism. It was shown to be a dendritic cell survival factor, T-cell activator and osteoclast regulator because RANKL mediates the osteoclast differentiation, survival and activation. Native RANKL is a type II trans-membrane protein with an extracellular binding domain that interacts with RANK and OPG receptors. OPG protects the skeleton from excessive bone resorption by binding to RANKL and preventing it from binding to its receptor, RANK. Thus, RANKL/OPG ratio became an important determinant of bone mass and skeletal integrity. In addition, this protein was shown to activate anti-apoptotic kinase AKT/PKB through a signalling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TREAF). Recent findings shown that OPG/RANK/RANKL system has been identifies as a possible mediator of arterial calcification suggesting common links between osteoporosis and vascular diseases.
Synonyms: Tumor necrosis factor ligand superfamily member 11 (TNFSF11), Osteoprotegerin ligand (OPGL), TNF-related activation-induced cytokine (TRANCE)
Characteristics Human recombinant protein expressed in Nicotiana benthamiana. Recombinant human Receptor activator of nuclear factor kappa-B ligand (sRANK-ligand) contains a 10-His tag at the N-terminal end, is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal free product.
Ext. Coeff. Abs (280nm) 0.1% (=1g/l): E 0.1% (1g/L) = 1.678 (A 280 nm)
p.I.: 6,82
Biological Activity: The specific activity is determined by the dose-dependent stimulation of IL-8 production in human PBMC. Activity results may vary with PBMC donors.
Biological Activity ng/ml: Human PBMC stimulated with 10ng/ml of Human recombinant sRANKL increases in three times the basal production of IL-8.
Specificity Serological Identification: The protein was electrophoresed under reducing condition on a 15% SDS-polyacrylamide gel, transferred by electro blotting to a NC membrane and visualized by immune-detection with specific RANKL antibody.
Molecular Weight Recombinant Human sRANKL is a glycosylated polypeptide chain containing 175 amino acids (70 – 244 aa of O14788 TNF11_HUMAN) and a His-tag at the N-terminal end. It has a predicted molecular mass of 21.1 kDa, however as result of glycosylation, the recombi

Application Details

Handling Advice Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
Purity > 97% by SDS-PAGE gel
Purification sequential chromatography (FPLC)
Buffer Recombinant human RANKL is lyophilized from 10mM Phosphate Potasium buffer pH 8 and 0.2M NaCl.
Storage This lyophilized preparation is stable at 2-8º C for short term, long storage it should be kept at -20ºC.
Restrictions For Research Use only

Publications

Product Anderson, Maraskovsky, Billingsley et al.: "A homologue of the TNF receptor and its ligand enhance T-cell growth and dendritic-cell function." in: Nature, Vol. 390, Issue 6656, pp. 175-9, 1997 (PubMed).

Yasuda, Shima, Nakagawa et al.: "Osteoclast differentiation factor is a ligand for osteoprotegerin/osteoclastogenesis-inhibitory factor and is identical to TRANCE/RANKL." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 95, Issue 7, pp. 3597-602, 1998 (PubMed).

Takahashi, Udagawa, Suda: "A new member of tumor necrosis factor ligand family, ODF/OPGL/TRANCE/RANKL, regulates osteoclast differentiation and function." in: Biochemical and biophysical research communications, Vol. 256, Issue 3, pp. 449-55, 1999 (PubMed).

Suda, Takahashi, Udagawa et al.: "Modulation of osteoclast differentiation and function by the new members of the tumor necrosis factor receptor and ligand families." in: Endocrine reviews, Vol. 20, Issue 3, pp. 345-57, 1999 (PubMed).

DAmelio, Isaia, Isaia: "The osteoprotegerin/RANK/RANKL system: a bone key to vascular disease." in: Journal of endocrinological investigation, Vol. 32, Issue 4 Suppl, pp. 6-9, 2009 (PubMed).

Alternatives

Alternatives for antigen "sRANK Ligand Active (Receptor activator of nuclear factor kappa-B ligand)", type "Proteins"
Reactivities Human (2)