tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, beta Polypeptide (YWHAB) protein (GST)

Name: tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, beta Polypeptide (YWHAB)

Synonyms: HS1, GW128, KCIP-1, 1300003C17Rik, ywhab, MGC53093, MGC78918, 14-3-3beta, hs1, gw128, kcip-1, YWHAB, 1433b, DKFZp459L1720

Protein Type: Recombinant

Origin (Gene): Human

Conjugate: GST

Application: SDS-PAGE (SDS), ELISA, Western Blotting (WB)

Certificates: ISO 9001:2008

Catalog no.: ABIN618760

Additional Information

Gene ID: NM_003404

Sequence: MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSN EERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQM GKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKK EMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDE AIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD AGEGEN

Description: Background: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Synonyms: Alternative name(s): Protein 1054 Protein kinase C inhibitor protein 1 Short name=KCIP-1 Cleaved into the following chain: 14-3-3 protein beta/alpha, N-terminally processed.

Molecular Weight: 28 KD

Application Details

Purity: 95%

Buffer: PBS buffer, 20mM GSH

Storage: Store at -20 C, for extended storage, conserve at -20 C or -80 C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 C for up to one week.

Research Area: Transcription Factors

Restrictions: For Research Use only