Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
40S ribosomal protein S10 protein (GST)
| Name | 40S ribosomal protein S10 |
| Protein Type | Recombinant |
| Origin (Gene) |
Human |
| Conjugate |
GST
|
| Application |
SDS-PAGE (SDS), ELISA, Western Blotting (WB)
|
| Certificates | ISO 9001:2008 |
| Catalog no. | ABIN618791 |
| Quantity | 1 mg |
| Price | 3,199.00 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Gene ID | NM_001014 |
| Sequence | PKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNL HVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYL HLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEAD RDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQP PQ |
| Description | Background: Component of the 40S ribosomal subunit. Defects in RPS10 are the cause of Diamond-Blackfan anemia type 9 (DBA9) [MIM:613308]. It is a form of Diamond-Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre- Robin syndrome and cleft palate), thumb and urogenital anomalies. |
| Molecular Weight | 18 KD |
