Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ) protein (HIS)

Name: Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ)

Synonyms: ACDC, ADPN, APM1, APM-1, GBP28, ACRP30, ADIPQTL1, adiponectin, APN, Acdc, apM1, 30kDa, adipo, Acrp30, ADIPOQ, MGC138982, ADN, MGC84292

Protein Type: Recombinant

Origin (Gene): Human

Conjugate: HIS

Application: ELISA, Western Blotting (WB)

Certificates: ISO 9001:2008

Catalog no.: ABIN618892

Additional Information

Gene ID: NM_001177800.1

Sequence: ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGR DGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQ GRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYN QQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKK DKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGE GERNGLYADNDNDSTFTGFLLYHDTN

Description: Background: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.

Molecular Weight: 30 KD

Application Details

Purity: 90%

Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0, 200 mM Imidazole

Storage: Store at -20 C, for extended storage, conserve at -20 C or -80 C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 C for up to one week.

Research Area: Cancer, Atherosclerosis, Metabolism, Hormones

Restrictions: For Research Use only