anti-Human FHOD3 antibody for Immunocytochemistry

Recommended FHOD3 Antibody (supplied by: Log in to see )

Antigen
Formin Homology 2 Domain Containing 3 (FHOD3) Antibodies
  • FHOS2
  • Formactin2
  • A930009H06Rik
  • mKIAA1695
  • formin homology 2 domain containing 3b
  • formin homology 2 domain containing 3
  • fhod3b
  • FHOD3
  • Fhod3
Reactivity
Human
8
3
3
3
3
3
3
Host
Rabbit
8
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
6
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4311639
Contact our Customer Service for availability and price in your country.

General

Antigen Formin Homology 2 Domain Containing 3 (FHOD3) Antibodies
Reactivity Human
(8), (3), (3), (3), (3), (3), (3)
Host Rabbit
(8)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(6), (3), (1)
Supplier Log in to see

Product Details anti-FHOD3 Antibody

Target Details FHOD3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRRRSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQV
Isotype IgG

Target Details FHOD3

Product Details anti-FHOD3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name FHOD3 (FHOD3 Antibody Abstract)
Background Gene Symbol: FHOD3
Gene ID 80206
Pathways Regulation of Actin Filament Polymerization

Application Details

Product Details anti-FHOD3 Antibody Target Details FHOD3 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-FHOD3 Antibody Target Details FHOD3 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-FHOD3 Antibody Target Details FHOD3 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) antibody (ABIN4311639) Immunocytochemistry/Immunofluorescence: FHOD3 Antibody [NBP1-83898] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) antibody (ABIN4311639) Immunohistochemistry-Paraffin: FHOD3 Antibody [NBP1-83898] Staining of human cerebral...