anti-Human Bicaudal D Homolog 1 (Drosophila) antibody for Western Blotting

Recommended Bicaudal D Homolog 1 (Drosophila) Antibody (supplied by: Log in to see )

Antigen
Bicaudal D Homolog 1 (Drosophila) (BICD1) Antibodies
  • BICD
  • B830009D06Rik
  • mKIAA4125
  • bicaudal D homolog 1
  • bicaudal D homolog 1 (Drosophila)
  • bicd1
  • BICD1
  • Bicd1
Reactivity
Human
16
7
7
1
1
1
1
1
1
Host
Rabbit
15
1
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
14
8
4
4
3
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4284608
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.2182703 ABIN4284605 ELISA ICC IF WB Rabbit C-Term Log in to see Polyclonal
3.2182703 ABIN4284607 IP WB Rabbit AA 550-600 Log in to see Polyclonal
3.2182703 ABIN1030294 ICC ELISA WB Rabbit C-Term Log in to see Polyclonal
1 ABIN1001896 ELISA WB Rabbit IgG C-Term Log in to see Polyclonal 3
1 ABIN5554607 EIA IF WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN299169 ELISA WB Rabbit C-Term Log in to see Polyclonal
1 ABIN1977014 IP WB Rabbit IgG AA 550-600 Log in to see Polyclonal
1 ABIN560059 ELISA WB Mouse AA 1-70, partial Log in to see Polyclonal
1 ABIN5516482 WB Rabbit Middle Region Log in to see Polyclonal
1 ABIN1887005 ICC ELISA WB Rabbit C-Term Log in to see Polyclonal
1 ABIN2590246 WB Rabbit N-Term Log in to see Polyclonal
1 ABIN5516481 WB Rabbit N-Term Log in to see Polyclonal
1 ABIN1584095 ICC ELISA WB Rabbit Log in to see Polyclonal
1 ABIN2210323 IC IF ELISA WB Rabbit IgG C-Term Log in to see Polyclonal

General

Antigen Bicaudal D Homolog 1 (Drosophila) (BICD1) Antibodies
Reactivity Human
(16), (7), (7), (1), (1), (1), (1), (1), (1)
Host Rabbit
(15), (1)
Clonality
Polyclonal
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(14), (8), (4), (4), (3), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product details

Target details Application Details Handling References Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE
Isotype IgG

Target details

Product details Application Details Handling References Images back to top
Antigen
Alternative Name BICD1 (BICD1 Antibody Abstract)
Background Gene Symbol: BICD1
Gene ID 636
Pathways Ribonucleoprotein Complex Subunit Organization, Regulation of G-Protein Coupled Receptor Protein Signaling, Maintenance of Protein Location

Application Details

Product details Target details Handling References Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target details Application Details References Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References

Product details Target details Application Details Handling Images back to top
Product cited in:

Terenzio, Golding, Russell, Wicher, Rosewell, Spencer-Dene, Ish-Horowicz, Schiavo: "Bicaudal-D1 regulates the intracellular sorting and signalling of neurotrophin receptors." in: The EMBO journal, Vol. 33, Issue 14, pp. 1582-98, 2014

Images

Product details Target details Application Details Handling References back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Bicaudal D Homolog 1 (Drosophila) (BICD1) antibody (ABIN4284608) Immunohistochemistry-Paraffin: BICD1 Antibody [NBP1-85843] - Staining of human rectum...
Western Blotting (WB) image for anti-Bicaudal D Homolog 1 (Drosophila) (BICD1) antibody (ABIN4284608) Western Blot: BICD1 Antibody [NBP1-85843] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...