anti-Human ABI1 antibody for Immunofluorescence

Recommended ABI1 Antibody (supplied by: Log in to see )

Antigen
Abl-Interactor 1 (ABI1) Antibodies
  • ABA INSENSITIVE 1
  • AtABI1
  • F20B18.190
  • F20B18_190
  • PROTEIN PHOSPHATASE 2C ABI1
  • abi1
  • wu:fc66g09
  • wu:fk56a10
  • zgc:73174
  • MGC84356
  • ABI1
  • abi-1
  • e3b1
  • nap1bp
  • ssh3bp
  • ssh3bp1
  • abi-2
  • abi2b
  • aip-1
  • ablbp3
  • argbpia
  • argbpib
  • ssh3bp2
  • wu:fe48a10
  • zgc:153534
  • DKFZp469P1319
  • ABI-1
  • ABLBP4
  • E3B1
  • NAP1BP
  • SSH3BP
  • SSH3BP1
  • NAP1
  • Ssh3bp1
  • E3b1
  • protein phosphatase 2C 56
  • abl-interactor 1a
  • abl-interactor 1
  • abl-interactor 2
  • abl-interactor 1b
  • Abl-interactor 1
  • Abl interactor 1
  • ABI1
  • abi1a
  • abi1
  • abi2
  • abi1b
  • Bm1_44660
  • LOAG_04356
  • Abi1
Reactivity
Human
100
64
59
11
11
10
9
7
7
6
6
4
4
2
2
1
1
Host
Rabbit
99
3
Clonality
Polyclonal
Conjugate
This ABI1 antibody is un-conjugated
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
71
32
21
19
14
13
13
11
6
4
3
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5074814
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.158281 ABIN5074815 ICC IF WB Rabbit IgG Log in to see Polyclonal
1 ABIN652475 FACS IF IHC (p) WB Rabbit Ig AA 81-108, N-Term Log in to see Polyclonal 1
1 ABIN252998 ICC IF IHC IHC (p) WB Rabbit AA 325-375 Log in to see Polyclonal 1
1 ABIN5553821 EIA FACS IF IHC (p) WB Rabbit AA 87-117, N-Term Log in to see Polyclonal
1 ABIN1105192 IHC (fro) IF IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN608969 ICC IHC (fro) IF IHC (p) IP WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN962211 IHC (fro) IF ELISA WB Mouse IgG2b Log in to see
1 ABIN1804583 FACS IF IHC (p) WB Rabbit AA 81-108 Log in to see Polyclonal
1 ABIN1890692 IF IHC (p) WB Rabbit IgG AA 325-375 Log in to see Polyclonal
1 ABIN5533740 FACS IF IHC (p) WB Rabbit Ig Fraction AA 81-108, N-Term Log in to see Polyclonal
1 ABIN1105193 EIA IF WB Rabbit C-Term Log in to see Polyclonal
1 ABIN2194040 IC IF IP IHC WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1082459 IF ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN1082460 IF ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN2613803 IF IHC (p) Rabbit IgG AA 325-375 Log in to see Polyclonal
1 ABIN2407090 IF ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN2132795 IF ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN2961670 FACS IF IHC (p) WB Rabbit AA 87-117, N-Term Log in to see Polyclonal
1 ABIN2793423 FACS IF IHC WB Rabbit Ig Fraction N-Term Log in to see Polyclonal

General

Antigen Abl-Interactor 1 (ABI1) Antibodies
Reactivity Human
(100), (64), (59), (11), (11), (10), (9), (7), (7), (6), (6), (4), (4), (2), (2), (1), (1)
Host Rabbit
(99), (3)
Clonality
Polyclonal
Conjugate This ABI1 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(71), (32), (21), (19), (14), (13), (13), (11), (6), (4), (3), (2), (2)
Supplier Log in to see

Product Details anti-ABI1 Antibody

Target Details ABI1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQ
Isotype IgG

Target Details ABI1

Product Details anti-ABI1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ABI1 (ABI1 Antibody Abstract)
Background Gene Symbol: ABI1
Gene ID 10006
Pathways RTK Signaling, Response to Water Deprivation, ER-Nucleus Signaling

Application Details

Product Details anti-ABI1 Antibody Target Details ABI1 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ABI1 Antibody Target Details ABI1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ABI1 Antibody Target Details ABI1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Abl-Interactor 1 (ABI1) antibody (ABIN5074814) Immunocytochemistry/Immunofluorescence: ABI1 Antibody - Staining of human cell line ...