You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human ACTR3 antibody for Immunohistochemistry

Recommended ACTR3 Antibody (supplied by: Log in to see )

ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) Antibodies
  • Tb03.27C5.490
  • DDBDRAFT_0218534
  • DDBDRAFT_0219936
  • DDB_0218534
  • DDB_0219936
  • actr3
  • MGC53892
  • ACTR3
  • ARP3
  • ATARP3
  • F3F19.20
  • F3F19_20
  • 1200003A09Rik
  • Arp3
  • actin-like protein
  • actin-like protein 3
  • Actin-like protein 3
  • actin related protein 3
  • LOC100281189
  • ARP3 actin-related protein 3 homolog (yeast)
  • ARP3 actin-related protein 3 homolog B (yeast)
  • actin-related protein 3
  • ARP3 actin-related protein 3
  • Tc00.1047053508277.330
  • Tc00.1047053508153.600
  • Tb927.3.3020
  • Tb09.160.3850
  • Tb11.01.1870
  • TVAG_371880
  • arpC
  • cl6346_1
  • LOC100281262
  • actr3
  • ACTR3
  • ACTR3B
  • DIS1
  • Actr3
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4278166
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.2386675 ABIN4890851 IHC WB Rabbit N-Term Log in to see Polyclonal
9.2386675 ABIN2403820 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2784770 IHC WB Rabbit N-Term Log in to see Polyclonal
1 ABIN1870794 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4278164 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN3021339 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4278165 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN2888085 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2893993 IHC WB Rabbit Log in to see Polyclonal
1 ABIN4252532 IHC WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2693871 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1994716 IHC WB Rabbit IgG Log in to see
1 ABIN2195644 IF IHC ELISA WB Mouse IgG1 kappa AA 1-418 Log in to see 2B6
1 ABIN2989091 IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2925263 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2796504 FACS IHC WB Rabbit Ig Fraction C-Term Log in to see Polyclonal

Similar anti-ACTR3 Antibodies

Application / Reactivity Human
ELISA 17 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 4 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (IF) 6 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies
Immunohistochemistry (IHC) 17 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Western Blotting (WB) 44 Antibodies


Antigen ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) Antibodies
Reactivity Human
(45), (22), (22), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(41), (4)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(43), (17), (16), (6), (6), (4), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-ACTR3 Antibody

Target Details ACTR3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDH
Isotype IgG

Target Details ACTR3

Product Details anti-ACTR3 Antibody Application Details Handling Images back to top
Alternative Name ACTR3 (ACTR3 Antibody Abstract)
Background Gene Symbol: ACTR3
Gene ID 10096
UniProt P61158
Pathways RTK Signaling, Regulation of Actin Filament Polymerization

Application Details

Product Details anti-ACTR3 Antibody Target Details ACTR3 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-ACTR3 Antibody Target Details ACTR3 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-ACTR3 Antibody Target Details ACTR3 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-ACTR3 antibody (ARP3 Actin-Related Protein 3 Homolog (Yeast)) (ABIN4278166) Immunohistochemistry: ACTR3 Antibody [NBP2-33623] - lymphoma
Western Blotting (WB) image for anti-ACTR3 antibody (ARP3 Actin-Related Protein 3 Homolog (Yeast)) (ABIN4278166) Western Blot: ACTR3 Antibody [NBP2-33623] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunohistochemistry (IHC) image for anti-ACTR3 antibody (ARP3 Actin-Related Protein 3 Homolog (Yeast)) (ABIN4278166) Immunohistochemistry: ACTR3 Antibody [NBP2-33623] - stomach
Immunohistochemistry (IHC) image for anti-ACTR3 antibody (ARP3 Actin-Related Protein 3 Homolog (Yeast)) (ABIN4278166) Immunohistochemistry: ACTR3 Antibody [NBP2-33623] - Immunohistochemical staining of h...