anti-Human ACTR3 antibody for Immunohistochemistry

Recommended ACTR3 Antibody (supplied by: Log in to see )

Antigen
ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) Antibodies
  • Tb03.27C5.490
  • DDBDRAFT_0218534
  • DDBDRAFT_0219936
  • DDB_0218534
  • DDB_0219936
  • actr3
  • MGC53892
  • ACTR3
  • ARP3
  • ACTIN-RELATED PROTEIN 3
  • ARABIDOPSIS THALIANA ACTIN-RELATED PROTEIN 3
  • ATARP3
  • DISTORTED TRICHOMES 1
  • F3F19.20
  • F3F19_20
  • 1200003A09Rik
  • Arp3
  • actin-like protein
  • actin-like protein 3
  • Actin-like protein 3
  • actin related protein 3
  • LOC100281189
  • ARP3 actin-related protein 3 homolog (yeast)
  • ARP3 actin-related protein 3 homolog B (yeast)
  • actin-related protein 3
  • ARP3 actin-related protein 3
  • Tc00.1047053508277.330
  • Tc00.1047053508153.600
  • Tb927.3.3020
  • Tb09.160.3850
  • Tb11.01.1870
  • TVAG_371880
  • arpC
  • cl6346_1
  • LOC100281262
  • actr3
  • ACTR3
  • ACTR3B
  • DIS1
  • Actr3
Epitope
N-Term
9
4
2
2
2
2
2
2
2
1
1
1
1
1
Reactivity
Human
50
26
24
3
3
3
3
2
2
2
2
1
1
1
Host
Rabbit
44
6
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
47
20
18
7
6
5
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4890851
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.13605 ABIN4278166 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
9.13605 ABIN2403820 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2784770 IHC WB Rabbit N-Term Log in to see Polyclonal
1 ABIN1870794 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4278164 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN3021339 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4278165 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN5611286 ELISA FACS IHC WB Mouse IgG1 AA 287-418 Log in to see 3G2C9
1 ABIN5611287 ELISA ICC IHC WB Mouse IgG1 AA 287-418 Log in to see 3G2G1
1 ABIN2888085 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4252532 IHC WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2893993 IHC WB Rabbit Log in to see Polyclonal
1 ABIN1994716 IHC WB Rabbit IgG Log in to see
1 ABIN2693871 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2195644 IF IHC ELISA WB Mouse IgG1 kappa AA 1-418 Log in to see 2B6
1 ABIN2989091 IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2925263 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2796504 FACS IHC WB Rabbit Ig Fraction C-Term Log in to see Polyclonal

General

Antigen ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) Antibodies
Epitope N-Term
(9), (4), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human
(50), (26), (24), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(44), (6)
Clonality
Polyclonal
Application Immunohistochemistry (IHC), Western Blotting (WB)
(47), (20), (18), (7), (6), (5), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-ACTR3 Antibody

Target Details ACTR3 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to ACTR3(ARP3 actin-related protein 3 homolog (yeast)) Antibody(against the N terminal of ACTR3 (NP_005712). Peptide sequence IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE.

Target Details ACTR3

Product Details anti-ACTR3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ACTR3 (ACTR3 Antibody Abstract)
Background Gene Symbol: ACTR3
Molecular Weight Theoretical MW: 47 kDa
Gene ID 10096
UniProt P61158
Pathways RTK Signaling, Regulation of Actin Filament Polymerization

Application Details

Product Details anti-ACTR3 Antibody Target Details ACTR3 Handling Images back to top
Application Notes Western Blot 0.2-1 μg/mL, ImmunohistochemistryThis is a rabbit polyclonal antibody against ACTR3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ACTR3 Antibody Target Details ACTR3 Application Details Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

Images

Product Details anti-ACTR3 Antibody Target Details ACTR3 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) (N-Term) antibody (ABIN4890851) Immunohistochemistry: ACTR3 Antibody [NBP1-56406] - Formalin Fixed Paraffin Embedded ...
Western Blotting (WB) image for anti-ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) (N-Term) antibody (ABIN4890851) Western Blot: ACTR3 Antibody [NBP1-56406] - Reccomended Titration: 0.2 - 1 ug/ml ELIS...