You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human ACTR3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended ACTR3 Antibody (supplied by: Log in to see )

Antigen
ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) Antibodies
  • 1200003A09Rik
  • ACTIN-RELATED PROTEIN 3
  • actr3
  • ACTR3
  • ARABIDOPSIS THALIANA ACTIN-RELATED PROTEIN 3
  • Arp3
  • ARP3
  • ATARP3
  • DDBDRAFT_0218534
  • DDBDRAFT_0219936
  • DDB_0218534
  • DDB_0219936
  • DISTORTED TRICHOMES 1
  • F3F19.20
  • F3F19_20
  • MGC53892
  • Tb03.27C5.490
Reactivity
Human
43
14
14
Host
Rabbit
39
4
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
40
17
14
5
4
4
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4278165
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.24605742 ABIN4278164 IHC IHC (p) WB Rabbit Log in to see Polyclonal
0.0008917009 ABIN389423 FACS IHC (p) WB Rabbit Ig AA 380-407, C-Term Log in to see Polyclonal 1
0.0008917009 ABIN564363 IF IHC (p) ELISA WB Mouse IgG1 kappa AA 1-418, full length Log in to see 2B6 2
0.0008917009 ABIN1805648 FACS IHC (p) WB Rabbit AA 387-416 Log in to see Polyclonal
0.0008917009 ABIN4278166 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-ACTR3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-ACTR3 Antibodies

Application / Reactivity Human
ELISA 17 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 4 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (IF) 4 Antibodies
Immunohistochemistry (IHC) 15 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 6 Antibodies
Western Blotting (WB) 41 Antibodies

General

Antigen ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) Antibodies
Reactivity Human
(43), (14), (14)
Host Rabbit
(39), (4)
Clonality
Polyclonal
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(40), (17), (14), (5), (4), (4), (1), (1)
Supplier Log in to see

Product Details anti-ACTR3 Antibody

Target Details ACTR3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGR
Isotype IgG

Target Details ACTR3

Product Details anti-ACTR3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ACTR3 (ACTR3 Antibody Abstract)
Background Gene Symbol: ACTR3
UniProt P61158
Pathways RTK Signaling

Application Details

Product Details anti-ACTR3 Antibody Target Details ACTR3 Handling Images back to top
Application Notes Western Blot 1:250 - 1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ACTR3 Antibody Target Details ACTR3 Application Details Images back to top
Format Liquid
Buffer PBS and 40 % glycerol ( pH 7.2)
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ACTR3 Antibody Target Details ACTR3 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-ACTR3 antibody (ARP3 Actin-Related Protein 3 Homolog (Yeast)) (ABIN4278165) Western Blot: ACTR3 Antibody [NBP2-33477] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ACTR3 antibody (ARP3 Actin-Related Protein 3 Homolog (Yeast)) (ABIN4278165) Immunohistochemistry-Paraffin: ACTR3 Antibody [NBP2-33477] - Immunohistochemical stai...