You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Amphiregulin antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Amphiregulin Antibody (supplied by: Log in to see )

Antigen
Amphiregulin (AREG) Antibodies
  • AR
  • Sdgf
  • CRDGF
  • SDGF
  • AREG
  • AREG/SDGF
  • AREGB
  • amphiregulin
  • amphiregulin B
  • amphiregulin preproprotein-like
  • amphiregulin-like
  • Areg
  • AREG
  • AREGB
  • LOC100354550
  • LOC538751
  • LOC100050528
  • LOC100732447
Reactivity
Human
67
19
5
2
1
1
1
Host
Rabbit
58
10
2
2
1
1
Clonality
Polyclonal
Conjugate
This Amphiregulin antibody is un-conjugated
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
54
28
26
16
11
6
4
4
2
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4280428
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.701424 ABIN315501 IHC (p) IHC Rabbit AA 8-26 Log in to see Polyclonal
11.701424 ABIN4280429 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
11.701424 ABIN704996 IF (p) IHC (p) WB Rabbit IgG AA 100-150 Log in to see Polyclonal 1
1 ABIN392202 IHC (p) WB Rabbit Ig AA 222-252, C-Term Log in to see Polyclonal
1 ABIN2854897 IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN3201206 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG AA 20-100 Log in to see
1 ABIN1731927 IHC (p) Rabbit IgG AA 8-26 Log in to see Polyclonal
1 ABIN4280427 IHC IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN2477406 IHC (p) IP Rabbit IgG AA 8-26 Log in to see Polyclonal
1 ABIN2764819 IHC (p) Rabbit AA 8-26 Log in to see Polyclonal
1 ABIN2716079 EIA IHC (p) WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-Amphiregulin antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-Amphiregulin Antibodies

Application / Reactivity Human
ELISA 23 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 4 Antibodies
Immunofluorescence (IF) 4 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 1 Antibodies
Immunohistochemistry (IHC) 25 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 12 Antibodies
Immunoprecipitation (IP) 14 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 47 Antibodies

General

Antigen Amphiregulin (AREG) Antibodies
Reactivity Human
(67), (19), (5), (2), (1), (1), (1)
Host Rabbit
(58), (10), (2), (2), (1), (1)
Clonality
Polyclonal
Conjugate This Amphiregulin antibody is un-conjugated
(1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(54), (28), (26), (16), (11), (6), (4), (4), (2), (1), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-Amphiregulin Antibody

Target Details Amphiregulin Application Details Handling References for anti-Amphiregulin Antibody (ABIN4280428) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERC
Isotype IgG

Target Details Amphiregulin

Product Details anti-Amphiregulin Antibody Application Details Handling References for anti-Amphiregulin Antibody (ABIN4280428) Images back to top
Antigen
Alternative Name Amphiregulin (AREG Antibody Abstract)
Background Gene Symbol: AREG
Gene ID 374
UniProt P15514
Research Area Growth Factors, Cancer
Pathways RTK Signaling, EGFR Signaling Pathway

Application Details

Product Details anti-Amphiregulin Antibody Target Details Amphiregulin Handling References for anti-Amphiregulin Antibody (ABIN4280428) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200Immunohistochemistry retrieval recommended: HIER pH 6
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Amphiregulin Antibody Target Details Amphiregulin Application Details References for anti-Amphiregulin Antibody (ABIN4280428) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Amphiregulin Antibody (ABIN4280428)

Product Details anti-Amphiregulin Antibody Target Details Amphiregulin Application Details Handling Images back to top
Product cited in:

Barton, DAmato, Gordon, Lind, Spoelstra, Babbs, Heinz, Elias, Jedlicka, Jacobsen, Richer: "Multiple molecular subtypes of triple-negative breast cancer critically rely on androgen receptor and respond to enzalutamide in vivo." in: Molecular cancer therapeutics, Vol. 14, Issue 3, pp. 769-78, 2015 (Sample species: Human). Further details: Immunohistochemistry

Images

Product Details anti-Amphiregulin Antibody Target Details Amphiregulin Application Details Handling References for anti-Amphiregulin Antibody (ABIN4280428) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Amphiregulin antibody (AREG) (ABIN4280428) Immunohistochemistry-Paraffin: Amphiregulin Antibody [NBP1-87071] - Staining of human...
Immunohistochemistry (IHC) image for anti-Amphiregulin antibody (AREG) (ABIN4280428) Immunohistochemistry: Amphiregulin Antibody [NBP1-87071] - Immunohistochemical staini...