You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human ARPC1B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended ARPC1B Antibody (supplied by: Log in to see )

Antigen
Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) Antibodies
  • arc41
  • arpc1b
  • arx-3and3n122
  • p40-arc
  • p41-arc
  • ACTIN-RELATED PROTEIN C1
  • ARPC1
  • F16D14.14
  • F16D14_14
  • actin-related protein C1B
  • 41kDa
  • AA408064
  • AA408534
  • AA571392
  • AF007010
  • AW208418
  • L72
  • SOP2Hs
  • p41-ARC
  • ARC41
  • p40-ARC
  • actin related protein 2/3 complex, subunit 1B, 41kDa
  • actin-related protein C1B
  • ARP2/3 complex 41 kDa subunit
  • actin related protein 2/3 complex, subunit 1B
  • arpc1b-a
  • ARPC1B
  • EHI_094120
  • arpc1b-b
  • Arpc1b
Reactivity
Human, Mouse (Murine), Rat (Rattus)
58
19
13
8
8
7
5
4
4
2
2
1
1
1
1
Host
Rabbit
40
18
Clonality
Polyclonal
Conjugate
This ARPC1B antibody is un-conjugated
3
3
3
3
3
3
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
52
33
11
10
4
4
2
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4278119
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.69751 ABIN351466 IHC (p) ELISA WB Goat AA 2-14 Log in to see Polyclonal
1 ABIN652700 FACS IHC (p) WB Rabbit Ig AA 159-188, Center Log in to see Polyclonal 1
1 ABIN2855610 ICC IF IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN372937 EIA IHC (p) WB Goat N-Term Log in to see Polyclonal
1 ABIN4278121 IHC IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1731962 IHC (p) ELISA WB Goat N-Term Log in to see Polyclonal
1 ABIN1731960 IHC (p) WB Rabbit IgG AA 40-311 Log in to see Polyclonal
1 ABIN4278118 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN1805974 FACS IHC (p) WB Rabbit AA 159-188 Log in to see Polyclonal
1 ABIN2771096 IHC (p) IHC ELISA WB Goat N-Term Log in to see Polyclonal

Top referenced anti-ARPC1B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-ARPC1B Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 6 Antibodies 6 Antibodies 33 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies 1 Antibodies 2 Antibodies
Immunohistochemistry (IHC) 6 Antibodies 7 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antibodies 7 Antibodies
Western Blotting (WB) 10 Antibodies 16 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 2 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Flow Cytometry (FACS) 4 Antibodies

General

Antigen Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(58), (19), (13), (8), (8), (7), (5), (4), (4), (2), (2), (1), (1), (1), (1)
Host Rabbit
(40), (18)
Clonality
Polyclonal
Conjugate This ARPC1B antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(52), (33), (11), (10), (4), (4), (2), (2), (2)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-ARPC1B Antibody

Target Details ARPC1B Application Details Handling References for anti-ARPC1B Antibody (ABIN4278119) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Isotype IgG

Target Details ARPC1B

Product Details anti-ARPC1B Antibody Application Details Handling References for anti-ARPC1B Antibody (ABIN4278119) Images back to top
Antigen
Alternative Name Actin-Related Protein 2/3 Complex Subunit 1B (ARPC1B Antibody Abstract)
Background Gene Symbol: ARPC1B
Molecular Weight Theoretical MW: 41 kDa
Gene ID 10095
UniProt O15143
Pathways RTK Signaling, Regulation of Actin Filament Polymerization

Application Details

Product Details anti-ARPC1B Antibody Target Details ARPC1B Handling References for anti-ARPC1B Antibody (ABIN4278119) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin, HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ARPC1B Antibody Target Details ARPC1B Application Details References for anti-ARPC1B Antibody (ABIN4278119) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-ARPC1B Antibody (ABIN4278119)

Product Details anti-ARPC1B Antibody Target Details ARPC1B Application Details Handling Images back to top
Product cited in:

Abella, Galloni, Pernier, Barry, Kjær, Carlier, Way: "Isoform diversity in the Arp2/3 complex determines actin filament dynamics." in: Nature cell biology, Vol. 18, Issue 1, pp. 76-86, 2015 (Sample species: Human). Further details: Immunocytochemistry,Western Blotting,Immunofluorescence

Images

Product Details anti-ARPC1B Antibody Target Details ARPC1B Application Details Handling References for anti-ARPC1B Antibody (ABIN4278119) back to top
Supplier Images
Western Blotting (WB) image for anti-ARPC1B antibody (Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa) (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - La...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ARPC1B antibody (Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa) (ABIN4278119) Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody ...
Western Blotting (WB) image for anti-ARPC1B antibody (Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa) (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - La...