You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) ARPC2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended ARPC2 Antibody (supplied by: Log in to see )

Antigen
Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2) Antibodies
  • arc34
  • p34-arc
  • pnas-139
  • pro2446
  • Arpc2
  • Arc-p34
  • 2210023N03Rik
  • 34kDa
  • p34-Arc
  • fk84a07
  • wu:fa22f07
  • wu:fk84a07
  • zgc:77769
  • ARC34
  • PNAS-139
  • actin related protein 2/3 complex, subunit 2, 34kDa
  • actin related protein 2/3 complex, subunit 2
  • ARPC2
  • arpc2
  • Arpc2
Reactivity
Human, Mouse (Murine), Rat (Rattus)
101
36
35
7
5
2
1
1
1
Host
Rabbit
74
22
6
Clonality
Polyclonal
Conjugate
This ARPC2 antibody is un-conjugated
8
8
8
3
3
3
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
80
55
33
16
13
11
7
3
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4281691
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.398593 ABIN1714662 IF (p) IHC (p) WB Rabbit IgG AA 260-300 Log in to see Polyclonal
11.398593 ABIN442268 ICC IF IHC (p) IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN782909 EIA IHC (p) WB Goat C-Term Log in to see Polyclonal 3
1 ABIN374215 EIA IHC (p) WB Goat C-Term Log in to see Polyclonal 3
1 ABIN372935 EIA IHC (p) WB Goat IgG C-Term Log in to see Polyclonal
1 ABIN2855249 ICC IF IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN1731963 IHC (p) ELISA WB Goat C-Term Log in to see Polyclonal
1 ABIN1712177 IHC (p) WB HRP Rabbit IgG AA 260-300 Log in to see Polyclonal
1 ABIN1701160 IHC (p) WB Biotin Rabbit IgG AA 260-300 Log in to see Polyclonal

Top referenced anti-ARPC2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-ARPC2 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 8 Antibodies 8 Antibodies 55 Antibodies
Enzyme Immunoassay (EIA) 3 Antibodies 3 Antibodies
Immunocytochemistry (ICC) 4 Antibodies 4 Antibodies
Immunofluorescence (IF) 9 Antibodies 10 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies 11 Antibodies
Immunohistochemistry (IHC) 11 Antibodies 12 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antibodies 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 10 Antibodies 10 Antibodies
Western Blotting (WB) 23 Antibodies 24 Antibodies
ELISA (Capture) 1 Antibodies

General

Antigen Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(101), (36), (35), (7), (5), (2), (1), (1), (1)
Host Rabbit
(74), (22), (6)
Clonality
Polyclonal
Conjugate This ARPC2 antibody is un-conjugated
(8), (8), (8), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(80), (55), (33), (16), (13), (11), (7), (3), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-ARPC2 Antibody

Target Details ARPC2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Isotype IgG

Target Details ARPC2

Product Details anti-ARPC2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ARPC2 (ARPC2 Antibody Abstract)
Background Gene Symbol: ARPC2
Molecular Weight Theoretical MW: 34 kDa
Gene ID 10109
UniProt O15144
Research Area Signaling, Microfilaments, Cytoskeleton
Pathways RTK Signaling

Application Details

Product Details anti-ARPC2 Antibody Target Details ARPC2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ARPC2 Antibody Target Details ARPC2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ARPC2 Antibody Target Details ARPC2 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-ARPC2 antibody (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa) (ABIN4281691) Immunocytochemistry/Immunofluorescence: ARPC2 Antibody [NBP1-88852] - Staining of hum...
Western Blotting (WB) image for anti-ARPC2 antibody (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa) (ABIN4281691) Western Blot: ARPC2 Antibody [NBP1-88852] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ARPC2 antibody (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa) (ABIN4281691) Immunohistochemistry-Paraffin: ARPC2 Antibody [NBP1-88852] - Staining of human lymph ...
Western Blotting (WB) image for anti-ARPC2 antibody (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa) (ABIN4281691) Western Blot: ARPC2 Antibody [NBP1-88852] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...