You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human ARPC3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended ARPC3 Antibody (supplied by: Log in to see )

Antigen
Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3) Antibodies
  • 21kDa
  • 1110006A04Rik
  • AA408672
  • AI788639
  • ARC21
  • arc21
  • DDBDRAFT_0184576
  • DDBDRAFT_0201632
  • DDB_0184576
  • DDB_0201632
  • p21-Ar
  • p21-Arc
  • p21-arc
  • p21Arc
  • zgc:86828
Reactivity
Human, Mouse (Murine), Rat (Rattus)
73
24
20
5
4
2
2
1
1
1
1
1
Host
Rabbit
52
16
5
Clonality
Polyclonal
Conjugate
This ARPC3 antibody is un-conjugated
7
7
6
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
66
40
12
8
3
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4281692
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008917009 ABIN390532 IHC (p) WB Rabbit Ig AA 131-158, C-Term Log in to see Polyclonal 1
0.0008917009 ABIN2855247 IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
0.0008917009 ABIN291803 IHC (p) ELISA WB Goat C-Term Log in to see Polyclonal
0.0008917009 ABIN1832922 IHC (p) WB Rabbit IgG AA 1-178 Log in to see Polyclonal
0.0008917009 ABIN441426 IHC (p) IHC WB Rabbit IgG Log in to see Polyclonal
0.0008917009 ABIN1841301 IHC (p) WB Rabbit C-Term Log in to see Polyclonal
0.0008917009 ABIN2799843 IHC (f) IHC (p) IHC WB Rabbit IgG AA 1-178 Log in to see Polyclonal
0.0008917009 ABIN2582314 IHC (p) IHC ELISA WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-ARPC3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-ARPC3 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 6 Antibodies 9 Antibodies 40 Antibodies
Immunocytochemistry (ICC) 2 Antibodies 2 Antibodies 2 Antibodies
Immunofluorescence (IF) 3 Antibodies 3 Antibodies 3 Antibodies
Immunohistochemistry (IHC) 1 Antibodies 1 Antibodies 13 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies 1 Antibodies 9 Antibodies
Western Blotting (WB) 19 Antibodies 22 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antibodies
Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) 1 Antibodies

General

Antigen Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(73), (24), (20), (5), (4), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(52), (16), (5)
Clonality
Polyclonal
Conjugate This ARPC3 antibody is un-conjugated
(7), (7), (6), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(66), (40), (12), (8), (3), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-ARPC3 Antibody

Target Details ARPC3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSK
Isotype IgG

Target Details ARPC3

Product Details anti-ARPC3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ARPC3 (ARPC3 Antibody Abstract)
Background Gene Symbol: ARPC3
Pathways RTK Signaling

Application Details

Product Details anti-ARPC3 Antibody Target Details ARPC3 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ARPC3 Antibody Target Details ARPC3 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ARPC3 Antibody Target Details ARPC3 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-ARPC3 antibody (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa) (ABIN4281692) Western Blot: ARPC3 Antibody [NBP1-89016] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Western Blotting (WB) image for anti-ARPC3 antibody (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa) (ABIN4281692) Western Blot: ARPC3 Antibody [NBP1-89016] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ARPC3 antibody (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa) (ABIN4281692) Immunohistochemistry-Paraffin: ARPC3 Antibody [NBP1-89016] - Staining of human tonsil...