You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human EPH Receptor A8 antibody for Immunohistochemistry

Recommended EPH Receptor A8 Antibody (supplied by: Log in to see )

EPH Receptor A8 (EPHA8) Antibodies
  • TK
  • tke17-a
  • si:ch211-122l14.1
  • EPHA8
  • EEK
  • EK3
  • HEK3
  • AW047546
  • Eek
  • Hek3
  • mKIAA1459
  • EPH receptor A8
  • eph receptor A8
  • Eph receptor A8
  • epha8
  • EPHA8
  • Epha8
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4308693
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1885840 IHC WB Rabbit AA 1-247 Log in to see Polyclonal
1 ABIN1886222 IHC WB Rabbit AA 223-488 Log in to see Polyclonal

Similar anti-EPH Receptor A8 Antibodies

Application / Reactivity Human
ELISA 17 Antibodies
Immunohistochemistry (IHC) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies
Western Blotting (WB) 16 Antibodies


Antigen EPH Receptor A8 (EPHA8) Antibodies
Reactivity Human
(23), (6), (5)
Host Rabbit
(12), (11)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(17), (16), (2)
Supplier Log in to see

Product Details anti-EPH Receptor A8 Antibody

Target Details EPH Receptor A8 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG
Isotype IgG

Target Details EPH Receptor A8

Product Details anti-EPH Receptor A8 Antibody Application Details Handling Images back to top
Alternative Name EphA8 (EPHA8 Antibody Abstract)
Background Gene Symbol: EPHA8
Gene ID 2046
Pathways RTK Signaling

Application Details

Product Details anti-EPH Receptor A8 Antibody Target Details EPH Receptor A8 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-EPH Receptor A8 Antibody Target Details EPH Receptor A8 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-EPH Receptor A8 Antibody Target Details EPH Receptor A8 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-EPH Receptor A8 antibody (EPHA8) (ABIN4308693) Immunohistochemistry: EphA8 Antibody [NBP1-84893] - Staining of human small intestine...