anti-Human EPH Receptor B1 antibody for Western Blotting

Recommended EPH Receptor B1 Antibody (supplied by: Log in to see )

Antigen
EPH Receptor B1 (EPHB1) Antibodies
  • Xek
  • MGC89790
  • EPHB1
  • Ephb2
  • Erk
  • elk
  • ELK
  • EPHT2
  • Hek6
  • NET
  • 9330129L11
  • AW488255
  • C130099E04Rik
  • Cek6
  • ENSMUSG00000074119
  • Elk
  • Elkh
  • Net
  • CEK6
  • EK6
  • ephb1-a
  • xek
  • EPH receptor B1
  • Eph receptor B1
  • EPHB1
  • ephb1
  • Ephb1
Epitope
AA 56-88, N-Term
23
15
15
4
4
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
119
81
73
3
Host
Rabbit
106
15
7
3
Clonality
Polyclonal
Conjugate
This EPH Receptor B1 antibody is un-conjugated
5
5
5
3
3
3
3
3
3
3
3
3
3
3
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
78
40
36
22
21
6
5
3
3
3
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3042375
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.2182703 ABIN391917 IHC (p) WB Rabbit Ig AA 955-984, C-Term Log in to see Polyclonal 3
3.2182703 ABIN391918 WB Rabbit Ig Log in to see Polyclonal 1
3.2182703 ABIN359810 EIA IHC (p) WB Rabbit Ig C-Term Log in to see Polyclonal 1
3.2182703 ABIN359811 EIA WB Rabbit Ig Log in to see Polyclonal 5
3.2182703 ABIN3184507 ELISA WB Rabbit IgG C-Term Log in to see Polyclonal
3.2182703 ABIN449958 ELISA ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 5F10A4
3.2182703 ABIN408383 WB Rabbit IgG pTyr330 Log in to see Polyclonal
3.2182703 ABIN2736709 WB Rabbit IgG Log in to see Polyclonal
3.2182703 ABIN499010 WB Rabbit Log in to see Polyclonal
3.2182703 ABIN498198 IF IHC (p) WB Rabbit Log in to see Polyclonal
3.2182703 ABIN407894 IHC (p) IHC WB Rabbit Log in to see Polyclonal
3.2182703 ABIN446736 WB Rabbit Log in to see Polyclonal
3.2182703 ABIN515338 WB Mouse AA 1-984, full length Log in to see Polyclonal
3.2182703 ABIN1107109 EIA IHC (p) WB Mouse IgG1 Log in to see 5F10A4 2
3.2182703 ABIN515340 ELISA WB Mouse IgG2a kappa AA 221-320, partial Log in to see 4G6
3.2182703 ABIN3030823 ELISA WB Rabbit Ig Fraction AA 374-409 Log in to see Polyclonal
3.2182703 ABIN515339 WB Mouse AA 1-984, full length Log in to see Polyclonal
3.2182703 ABIN1852704 ELISA WB Rabbit C-Term Log in to see Polyclonal
1 ABIN2869288 ELISA IHC WB Mouse IgG1 AA 19-133 Log in to see 5F10A4 2
1 ABIN1452081 ELISA WB Rabbit IgG AA 841-890 Log in to see Polyclonal 1

General

Antigen EPH Receptor B1 (EPHB1) Antibodies
Epitope AA 56-88, N-Term
(23), (15), (15), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human
(119), (81), (73), (3)
Host Rabbit
(106), (15), (7), (3)
Clonality
Polyclonal
Conjugate This EPH Receptor B1 antibody is un-conjugated
(5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(78), (40), (36), (22), (21), (6), (5), (3), (3), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-EPH Receptor B1 Antibody

Target Details EPH Receptor B1 Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1(EPHB1) detection. Tested with WB, IHC-P in Human.
Sequence RTYQVCNVFE PNQNNWLLTT FINRRGAHRI YTE
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1(EPHB1) detection. Tested with WB, IHC-P in Human.
Gene Name: EPH receptor B1
Protein Name: Ephrin type-B receptor 1
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE) , identical to the related mouse and rat sequences.
Isotype IgG

Target Details EPH Receptor B1

Product Details anti-EPH Receptor B1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name EPHB1 (EPHB1 Antibody Abstract)
Background Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

Synonyms: Cek 6 antibody|EK6 antibody|ELK antibody|Elkh antibody|EPH receptor B1 antibody|Eph tyrosine kinase 2 antibody|EPH-like kinase 6 antibody|Ephb1 antibody|EPHB1_HUMAN antibody|Ephrin type B receptor 1 antibody|Ephrin type-B receptor 1 antibody|EPHT2 antibody|HEK 6 antibody|HEK6 antibody|NET antibody|Neuronally-expressed EPH-related tyrosine kinase antibody|soluble EPHB1 variant 1 antibody| Tyrosine protein kinase receptor EPH 2 antibody|Tyrosine-protein kinase receptor EPH-2 antibody
Gene ID 2047
UniProt P54762
Pathways RTK Signaling

Application Details

Product Details anti-EPH Receptor B1 Antibody Target Details EPH Receptor B1 Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-EPH Receptor B1 Antibody Target Details EPH Receptor B1 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-EPH Receptor B1 Antibody Target Details EPH Receptor B1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-EPH Receptor B1 (EPHB1) (AA 56-88), (N-Term) antibody (ABIN3042375) Anti- Eph receptor B1 Picoband antibody, IHC(P) IHC(P): Human Glioma Tissue
Western Blotting (WB) image for anti-EPH Receptor B1 (EPHB1) (AA 56-88), (N-Term) antibody (ABIN3042375) Observed bind size: 111KD