anti-Human Ephrin A5 antibody for Immunocytochemistry

Recommended Ephrin A5 Antibody (supplied by: Log in to see )

Antigen
Ephrin A5 (EFNA5) Antibodies
  • EFNA5
  • af1
  • efl5
  • rags
  • eplg7
  • lerk7
  • AL-1
  • AV158822
  • EFL-5
  • Ephrin-A5
  • Epl7
  • LERK-7
  • RAGS
  • Lerk7
  • AF1
  • EFL5
  • EPLG7
  • GLC1M
  • LERK7
  • ephrin-A5-like
  • ephrin-A5
  • ephrin A5
  • LOC100073202
  • EFNA5
  • efna5
  • LOC100228846
  • Efna5
  • LOC100358004
  • LOC100513721
Reactivity
Human
62
48
43
9
8
6
5
5
4
3
2
2
2
1
1
Host
Rabbit
57
9
5
1
Clonality
Polyclonal
Conjugate
This Ephrin A5 antibody is un-conjugated
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
49
35
17
15
14
13
4
3
3
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5076560
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1867697 ICC IHC IP WB Rabbit IgG AA 21-203 Log in to see Polyclonal
1 ABIN2740477 FACS ICC IF IHC (p) WB Rabbit Internal Region Log in to see Polyclonal
1 ABIN2857564 ICC IF IHC WB Rabbit Log in to see Polyclonal

General

Antigen Ephrin A5 (EFNA5) Antibodies
Reactivity Human
(62), (48), (43), (9), (8), (6), (5), (5), (4), (3), (2), (2), (2), (1), (1)
Host Rabbit
(57), (9), (5), (1)
Clonality
Polyclonal
Conjugate This Ephrin A5 antibody is un-conjugated
(3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(49), (35), (17), (15), (14), (13), (4), (3), (3), (3), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-Ephrin A5 Antibody

Target Details Ephrin A5 Application Details Handling References for anti-Ephrin A5 antibody (ABIN5076560) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ
Isotype IgG

Target Details Ephrin A5

Product Details anti-Ephrin A5 Antibody Application Details Handling References for anti-Ephrin A5 antibody (ABIN5076560) Images back to top
Antigen
Alternative Name Ephrin-A5 (EFNA5 Antibody Abstract)
Background Gene Symbol: EFNA5
Gene ID 1946
Pathways RTK Signaling

Application Details

Product Details anti-Ephrin A5 Antibody Target Details Ephrin A5 Handling References for anti-Ephrin A5 antibody (ABIN5076560) Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Ephrin A5 Antibody Target Details Ephrin A5 Application Details References for anti-Ephrin A5 antibody (ABIN5076560) Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Ephrin A5 antibody (ABIN5076560)

Product Details anti-Ephrin A5 Antibody Target Details Ephrin A5 Application Details Handling Images back to top
Product cited in:

Andretta, Cartón-García, Martínez-Barriocanal, de Marcondes, Jimenez-Flores, Macaya, Bazzocco, Bilic, Rodrigues, Nieto, Landolfi, Ramon Y Cajal, Schwartz, Brown, Dopeso, Arango: "Investigation of the role of tyrosine kinase receptor EPHA3 in colorectal cancer." in: Scientific reports, Vol. 7, pp. 41576, 2017 Method employed by authors: Western Blotting (WB) (Sample species: Mouse (Murine)).

Images

Product Details anti-Ephrin A5 Antibody Target Details Ephrin A5 Application Details Handling References for anti-Ephrin A5 antibody (ABIN5076560) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Ephrin A5 (EFNA5) antibody (ABIN5076560) Immunocytochemistry/Immunofluorescence: Ephrin-A5 Antibody - Staining of human cell ...