anti-Human Ephrin B2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Ephrin B2 Antibody (supplied by: Log in to see )

Antigen
Ephrin B2 (EFNB2) Antibodies
  • EFNB2
  • efnb2
  • ephrin-B2
  • htkl
  • eplg5
  • htk-l
  • lerk5
  • ephrinB2
  • efnb2a
  • MGC68890
  • efnb2b
  • ELF-2
  • Epl5
  • Eplg5
  • Htk-L
  • LERK-5
  • Lerk5
  • NLERK-1
  • EPLG5
  • HTKL
  • LERK5
  • ephrin-B2
  • ephrin-B2 precursor
  • ephrin B2
  • EFNB2
  • efnb2
  • efnb2-a
  • LOC100357479
  • Efnb2
Reactivity
Human
104
50
31
5
5
5
3
3
3
2
2
1
1
Host
Rabbit
90
18
2
Clonality
Polyclonal
Conjugate
This Ephrin B2 antibody is un-conjugated
3
3
3
3
3
3
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
91
39
34
26
10
7
3
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4308730
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.588177 ABIN4308731 ICC IF IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN655599 IF IHC (p) WB Rabbit Ig AA 157-186, Center Log in to see Polyclonal 1
1 ABIN5556234 EIA IF IHC (p) WB Rabbit Ig Fraction AA 164-194, Middle Region Log in to see Polyclonal
1 ABIN5531138 IF IHC (p) WB Rabbit Ig Fraction AA 157-186 Log in to see Polyclonal
1 ABIN2962619 IF IHC (p) WB Rabbit AA 157-186 Log in to see Polyclonal
1 ABIN1978656 IF IHC (p) WB Rabbit AA 157-186 Log in to see Polyclonal

General

Antigen Ephrin B2 (EFNB2) Antibodies
Reactivity Human
(104), (50), (31), (5), (5), (5), (3), (3), (3), (2), (2), (1), (1)
Host Rabbit
(90), (18), (2)
Clonality
Polyclonal
Conjugate This Ephrin B2 antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(91), (39), (34), (26), (10), (7), (3), (2), (2), (2), (1)
Pubmed 3 references available
Supplier Log in to see

Product Details anti-Ephrin B2 Antibody

Target Details Ephrin B2 Application Details Handling References for anti-Ephrin B2 antibody (ABIN4308730) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
Isotype IgG

Target Details Ephrin B2

Product Details anti-Ephrin B2 Antibody Application Details Handling References for anti-Ephrin B2 antibody (ABIN4308730) Images back to top
Antigen
Alternative Name Ephrin B2 (EFNB2 Antibody Abstract)
Background Gene Symbol: EFNB2
Gene ID 1948
Research Area Neurology, Angiogenesis
Pathways RTK Signaling, Regulation of Muscle Cell Differentiation

Application Details

Product Details anti-Ephrin B2 Antibody Target Details Ephrin B2 Handling References for anti-Ephrin B2 antibody (ABIN4308730) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Ephrin B2 Antibody Target Details Ephrin B2 Application Details References for anti-Ephrin B2 antibody (ABIN4308730) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Ephrin B2 antibody (ABIN4308730)

Product Details anti-Ephrin B2 Antibody Target Details Ephrin B2 Application Details Handling Images back to top
Product cited in:

Nakayama, Nakayama, van Lessen, Yamamoto, Hoffmann, Drexler, Itoh, Hirose, Breier, Vestweber, Cooper, Ohno, Kaibuchi, Adams: "Spatial regulation of VEGF receptor endocytosis in angiogenesis." in: Nature cell biology, Vol. 15, Issue 3, pp. 249-60, 2013

Nakayama, Nakayama, Turner, Höing, Lepore, Adams: "Ephrin-B2 controls PDGFR? internalization and signaling." in: Genes & development, Vol. 27, Issue 23, pp. 2576-89, 2013

Dravis, Henkemeyer: "Ephrin-B reverse signaling controls septation events at the embryonic midline through separate tyrosine phosphorylation-independent signaling avenues." in: Developmental biology, Vol. 355, Issue 1, pp. 138-51, 2011 (Sample species: Mouse (Murine)). Further details: Western Blotting

Images

Product Details anti-Ephrin B2 Antibody Target Details Ephrin B2 Application Details Handling References for anti-Ephrin B2 antibody (ABIN4308730) back to top
Supplier Images
Western Blotting (WB) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Western Blot: Ephrin B2 Antibody [NBP1-84830] - Lane 1: Marker [kDa] 230, 130, 95, 72...
Western Blotting (WB) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Western Blot: Ephrin B2 Antibody [NBP1-84830] - Lane 1: NIH-3T3 cell lysate (Mouse em...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Immunohistochemistry-Paraffin: Ephrin B2 Antibody [NBP1-84830] - Staining of human he...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Immunohistochemistry-Paraffin: Ephrin B2 Antibody - Staining of human kidney shows m...
Immunofluorescence (IF) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Immunocytochemistry/Immunofluorescence: Ephrin B2 Antibody - Staining of human cell ...