anti-Human FGF1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended FGF1 Antibody (supplied by: Log in to see )

Antigen
Fibroblast Growth Factor 1 (Acidic) (FGF1) Antibodies
  • FGF1
  • zgc:136885
  • aFGF
  • ecgf
  • fgfa
  • ecgfa
  • ecgfb
  • fgf-1
  • hbgf1
  • HBGF-1
  • glio703
  • ecgf-beta
  • fgf-alpha
  • LOC100221393
  • FGF-1
  • Fgf1
  • Dffrx
  • Fam
  • Fgf-1
  • Fgfa
  • ECGF
  • AFGF
  • ECGF-beta
  • ECGFA
  • ECGFB
  • FGF-alpha
  • FGFA
  • GLIO703
  • HBGF1
  • fibroblast growth factor 1 (acidic)
  • fibroblast growth factor 1b
  • acidic fibroblast growth factor
  • fibroblast growth factor 1
  • fgf1
  • FGF1
  • fgf1b
  • LOC100221393
  • AFGF
  • Fgf1
Reactivity
Human
155
74
54
16
9
6
6
5
4
3
3
3
2
1
1
1
1
Host
Rabbit
163
52
Clonality
Polyclonal
Conjugate
This FGF1 antibody is un-conjugated
18
13
9
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
145
123
46
26
26
24
13
12
7
6
5
4
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4311439
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN390361 IF IHC (p) WB Rabbit Ig AA 5-30, N-Term Log in to see Polyclonal 1
1 ABIN3044308 ELISA IHC (p) WB Rabbit IgG AA 16-155 Log in to see Polyclonal
1 ABIN4886581 ELISA IHC (p) WB Rabbit IgG AA 16-155 Log in to see Polyclonal
1 ABIN781862 EIA IF IHC (p) IP WB Mouse IgG1 Log in to see 2-00E-012
1 ABIN781861 EIA IF IHC (p) WB Mouse IgG1 Log in to see 1F9
1 ABIN626047 IF IHC (p) IP ELISA WB Mouse IgG1, kappa AA 46-155 Log in to see 2E12
1 ABIN626048 IF IHC (p) ELISA WB Mouse IgG1, kappa AA 46-155 Log in to see 1F9
1 ABIN116006 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN726590 IF (p) IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN1498254 IHC (p) Neut ELISA WB Rabbit Log in to see Polyclonal
1 ABIN2450557 IP IHC (p) Neut ELISA WB Rabbit IgG AA 16-155 Log in to see Polyclonal
1 ABIN116005 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2892580 IHC (p) Rabbit His56 Log in to see Polyclonal
1 ABIN515608 IF IHC (p) IP ELISA WB Mouse IgG1 kappa AA 46-155, partial Log in to see 2E12
1 ABIN515609 IF IHC (p) ELISA WB Mouse IgG1 kappa AA 46-155, partial Log in to see 1F9
1 ABIN726599 IHC (p) HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1723661 IF IHC (p) ELISA WB Mouse IgG1 kappa AA 46-155 Log in to see 1F9
1 ABIN1723660 IF IHC (p) IP ELISA WB Mouse IgG1 kappa AA 46-155 Log in to see (2E12)
1 ABIN2601884 ELISA IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN726592 IHC (p) Biotin Rabbit IgG Log in to see Polyclonal

Top referenced anti-FGF1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-FGF1 Antibodies

Application / Reactivity Human
Blocking Antibody (Inhibition) 1 Antibodies
ELISA 77 Antibodies
Enzyme Immunoassay (EIA) 6 Antibodies
Functional Studies (Func) 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 27 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 32 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 26 Antibodies
Immunoprecipitation (IP) 20 Antibodies
Neutralization (Neut) 12 Antibodies
Proximity Ligation Assay (PLA) 2 Antibodies
Radioimmunoassay (RIA) 1 Antibodies
Western Blotting (WB) 112 Antibodies

General

Antigen Fibroblast Growth Factor 1 (Acidic) (FGF1) Antibodies
Reactivity Human
(155), (74), (54), (16), (9), (6), (6), (5), (4), (3), (3), (3), (2), (1), (1), (1), (1)
Host Rabbit
(163), (52)
Clonality
Polyclonal
Conjugate This FGF1 antibody is un-conjugated
(18), (13), (9), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(145), (123), (46), (26), (26), (24), (13), (12), (7), (6), (5), (4), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-FGF1 Antibody

Target Details FGF1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHTDTK
Isotype IgG

Target Details FGF1

Product Details anti-FGF1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name FGF Acidic/FGF1 (FGF1 Antibody Abstract)
Background Gene Symbol: FGF1
Gene ID 2246
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-FGF1 Antibody Target Details FGF1 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-FGF1 Antibody Target Details FGF1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-FGF1 Antibody Target Details FGF1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-FGF1 antibody (Fibroblast Growth Factor 1 (Acidic)) (ABIN4311439) Immunocytochemistry/Immunofluorescence: FGF1 Antibody [NBP1-89213] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-FGF1 antibody (Fibroblast Growth Factor 1 (Acidic)) (ABIN4311439) Immunohistochemistry-Paraffin: FGF1 Antibody [NBP1-89213] - Staining of human kidney ...