You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human FGF19 antibody for Immunohistochemistry

Recommended FGF19 Antibody (supplied by: Log in to see )

Antigen
Fibroblast Growth Factor 19 (FGF19) Antibodies
  • FGF-19
  • Fgf15
  • FGF19
Reactivity
Human
84
3
3
2
Host
Rabbit
61
19
4
1
Clonality
Polyclonal
Conjugate
This FGF19 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
77
48
8
7
7
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4311583
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.001164044 ABIN1983189 IHC WB Mouse IgG1 AA 27-216 Log in to see MM0285-4G16
0.001164044 ABIN1101521 IHC ELISA WB Rabbit Internal Region Log in to see Polyclonal
0.001164044 ABIN2267231 IHC WB Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN2562584 IHC WB Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN4272057 IHC IHC (p) WB Mouse IgG1 Log in to see MM0285-4G16
0.001164044 ABIN4889138 ELISA IHC WB Rabbit Internal Region Log in to see Polyclonal
0.001164044 ABIN3047559 IHC WB Rabbit Log in to see Polyclonal

Similar anti-FGF19 Antibodies

Application / Reactivity Human
Blocking Peptide (BP) 1 Antibodies
ELISA 48 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunohistochemistry (IHC) 8 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antibodies
Immunoprecipitation (IP) 3 Antibodies
Neutralization (Neut) 7 Antibodies
Western Blotting (WB) 76 Antibodies

General

Antigen Fibroblast Growth Factor 19 (FGF19) Antibodies
Reactivity Human
(84), (3), (3), (2)
Host Rabbit
(61), (19), (4), (1)
Clonality
Polyclonal
Conjugate This FGF19 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(77), (48), (8), (7), (7), (3), (1), (1), (1)
Supplier Log in to see

Product Details anti-FGF19 Antibody

Target Details FGF19 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Isotype IgG

Target Details FGF19

Product Details anti-FGF19 Antibody Application Details Handling Images back to top
Antigen
Alternative Name FGF-19 (FGF19 Antibody Abstract)
Background Gene Symbol: FGF19
UniProt O95750
Research Area Growth Factors
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-FGF19 Antibody Target Details FGF19 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-FGF19 Antibody Target Details FGF19 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-FGF19 Antibody Target Details FGF19 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-FGF19 antibody (Fibroblast Growth Factor 19) (ABIN4311583) Immunohistochemistry: FGF-19 Antibody [NBP1-86294] - Staining of human gall bladder s...