anti-Human FGF5 antibody for Immunofluorescence

Recommended FGF5 Antibody (supplied by: Log in to see )

Antigen
Fibroblast Growth Factor 5 (FGF5) Antibodies
  • FGF5
  • HBGF-5
  • Smag-82
  • Fgf-5
  • angora
  • go
  • FGF-5
  • fibroblast growth factor 5
  • FGF5
  • fgf5
  • Fgf5
Reactivity
Human
87
18
16
4
Host
Rabbit
37
33
17
Clonality
Polyclonal
Conjugate
This FGF5 antibody is un-conjugated
4
4
4
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
59
38
21
21
13
7
4
3
3
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5076782
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.948822 ABIN515610 IF WB Mouse AA 1-123, full length Log in to see Polyclonal
1 ABIN2602007 IF WB Mouse IgG AA 1-123 Log in to see Polyclonal
1 ABIN2266574 IF WB Mouse IgG AA 1-123 Log in to see Polyclonal
1 ABIN3059902 ICC IF IP IHC WB Rabbit Log in to see Polyclonal

General

Antigen Fibroblast Growth Factor 5 (FGF5) Antibodies
Reactivity Human
(87), (18), (16), (4)
Host Rabbit
(37), (33), (17)
Clonality
Polyclonal
Conjugate This FGF5 antibody is un-conjugated
(4), (4), (4), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(59), (38), (21), (21), (13), (7), (4), (3), (3), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-FGF5 Antibody

Target Details FGF5 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Isotype IgG

Target Details FGF5

Product Details anti-FGF5 Antibody Application Details Handling Images back to top
Antigen
Alternative Name FGF-5 (FGF5 Antibody Abstract)
Background Gene Symbol: FGF5
Gene ID 2250
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-FGF5 Antibody Target Details FGF5 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-FGF5 Antibody Target Details FGF5 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-FGF5 Antibody Target Details FGF5 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Fibroblast Growth Factor 5 (FGF5) antibody (ABIN5076782) Immunocytochemistry/Immunofluorescence: FGF-5 Antibody - Staining of human cell line...
Western Blotting (WB) image for anti-Fibroblast Growth Factor 5 (FGF5) antibody (ABIN5076782) Western Blot: FGF-5 Antibody - Western blot analysis in human cell line RT-4, human ...