You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human GAS6 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended GAS6 Antibody (supplied by: Log in to see )

Antigen
Growth Arrest-Specific 6 (GAS6) Antibodies
  • fj34a12
  • zgc:63860
  • wu:fj34a12
  • MGC68463
  • gas6
  • MGC83872
  • GAS6
  • Gas-6
  • AXLLG
  • AXSF
  • growth arrest-specific 6
  • growth arrest specific 6
  • growth arrest-specific protein 6-like
  • GAS6
  • gas6
  • Gas6
  • LOC100519331
Reactivity
Human
57
29
23
Host
Rabbit
59
7
3
1
Clonality
Polyclonal
Conjugate
This GAS6 antibody is un-conjugated
4
4
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
54
25
25
13
8
7
5
5
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4313581
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.069163 ABIN873146 IF (p) IHC (p) WB Rabbit IgG AA 560-610 Log in to see Polyclonal
1 ABIN317613 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN898361 IHC (p) WB HRP Rabbit IgG AA 560-610 Log in to see Polyclonal
1 ABIN898363 IHC (p) WB Biotin Rabbit IgG AA 560-610 Log in to see Polyclonal
1 ABIN2892395 IHC (p) WB Rabbit Gly309 Log in to see Polyclonal

Top referenced anti-GAS6 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-GAS6 Antibodies

Application / Reactivity Human
ELISA 18 Antibodies
Immunocytochemistry (ICC) 4 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 18 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 6 Antibodies
Immunoprecipitation (IP) 3 Antibodies
Western Blotting (WB) 42 Antibodies

General

Antigen Growth Arrest-Specific 6 (GAS6) Antibodies
Reactivity Human
(57), (29), (23)
Host Rabbit
(59), (7), (3), (1)
Clonality
Polyclonal
Conjugate This GAS6 antibody is un-conjugated
(4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(54), (25), (25), (13), (8), (7), (5), (5), (2)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-GAS6 Antibody

Target Details GAS6 Application Details Handling References for anti-GAS6 Antibody (ABIN4313581) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:STWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTS
Isotype IgG

Target Details GAS6

Product Details anti-GAS6 Antibody Application Details Handling References for anti-GAS6 Antibody (ABIN4313581) Images back to top
Antigen
Alternative Name Gas6 (GAS6 Antibody Abstract)
Background Gene Symbol: GAS6
Gene ID 2621
Pathways RTK Signaling, Carbohydrate Homeostasis

Application Details

Product Details anti-GAS6 Antibody Target Details GAS6 Handling References for anti-GAS6 Antibody (ABIN4313581) Images back to top
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-GAS6 Antibody Target Details GAS6 Application Details References for anti-GAS6 Antibody (ABIN4313581) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-GAS6 Antibody (ABIN4313581)

Product Details anti-GAS6 Antibody Target Details GAS6 Application Details Handling Images back to top
Product cited in:

Pinato, Mauri, Lloyd, Vaira, Casadio, Boldorini, Sharma: "The expression of Axl receptor tyrosine kinase influences the tumour phenotype and clinical outcome of patients with malignant pleural mesothelioma." in: British journal of cancer, Vol. 108, Issue 3, pp. 621-8, 2013

Images

Product Details anti-GAS6 Antibody Target Details GAS6 Application Details Handling References for anti-GAS6 Antibody (ABIN4313581) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GAS6 antibody (Growth Arrest-Specific 6) (ABIN4313581) Immunohistochemistry-Paraffin: Gas6 Antibody [NBP1-90059] - Human cerebral cortex sho...
Western Blotting (WB) image for anti-GAS6 antibody (Growth Arrest-Specific 6) (ABIN4313581) Western Blot: Gas6 Antibody [NBP1-90059] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...