anti-Human MERTK antibody for Immunofluorescence

Recommended MERTK Antibody (supplied by: Log in to see )

Antigen
C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) Antibodies
  • C-EYK
  • MERTK
  • DKFZp469D2215
  • si:ch1073-268l12.2
  • MER
  • RP38
  • c-mer
  • Eyk
  • Mer
  • Nyk
  • nmf12
  • rdy
  • c-mer proto-oncogene tyrosine kinase
  • MERTK
  • LOC100219161
  • mertk
  • Mertk
Reactivity
Human
177
87
47
7
2
2
1
1
1
1
1
Host
Rabbit
115
37
34
26
Clonality
Polyclonal
Conjugate
This MERTK antibody is un-conjugated
12
11
8
7
6
5
5
5
4
4
4
4
3
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
128
95
68
41
29
20
16
15
13
13
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5078050
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.326117 ABIN3030229 FACS IF IHC ELISA WB Rabbit Ig Fraction Log in to see Polyclonal
1 ABIN152841 ELISA ICC IF IHC WB Rabbit pTyr749, pTyr753 Log in to see Polyclonal 1
1 ABIN392343 FACS IF IHC (p) WB Rabbit Ig Log in to see Polyclonal
1 ABIN596493 IF IP WB Rabbit IgG His925 Log in to see
1 ABIN5534530 FACS IF IHC (p) WB Rabbit Ig Fraction Log in to see Polyclonal
1 ABIN2750539 CM ICC IF IP IHC ELISA WB FITC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2750537 CM ICC IF IP IHC ELISA WB FITC Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2750538 CM ICC IF IP IHC ELISA WB FITC Rabbit IgG Middle Region Log in to see Polyclonal
1 ABIN2750543 CM ICC FACS IF IHC ELISA WB FITC Rabbit IgG phosphorylated Log in to see Polyclonal
1 ABIN2746864 CM ICC FACS IF IHC ELISA WB Rabbit IgG phosphorylated Log in to see Polyclonal
1 ABIN1840469 FACS IF IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2746860 CM ICC IF IP IHC ELISA WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2750536 CM ICC IF IP IHC ELISA WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2750535 CM ICC IF IP IHC ELISA WB Rabbit IgG Middle Region Log in to see Polyclonal
1 ABIN2793254 FACS IF IHC WB Rabbit Ig Fraction Log in to see Polyclonal
1 ABIN5558366 CM ELISA ICC IF IHC IP WB Biotin Rabbit N-Term Log in to see Polyclonal
1 ABIN5558368 CM ELISA ICC IF IHC IP WB Biotin Rabbit Middle Region Log in to see Polyclonal
1 ABIN5558369 CM ELISA FACS ICC IF IHC WB Biotin Rabbit phosphorylated Log in to see Polyclonal
1 ABIN5558367 CM ELISA ICC IF IHC IP WB Biotin Rabbit C-Term Log in to see Polyclonal
1 ABIN5558365 CM ELISA ICC IF IHC IP WB Rabbit Middle Region Log in to see Polyclonal

Top referenced anti-MERTK antibody for Immunofluorescence

Similar anti-MERTK Antibodies

Application / Reactivity Human
Confocal Microscopy (CM) 13 Antibodies
ELISA 93 Antibodies
ELISA (Capture) 2 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 26 Antibodies
Immunocytochemistry (ICC) 16 Antibodies
Immunofluorescence (IF) 21 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 53 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 14 Antibodies
Immunoprecipitation (IP) 16 Antibodies
Western Blotting (WB) 109 Antibodies

General

Antigen C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) Antibodies
Reactivity Human
(177), (87), (47), (7), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(115), (37), (34), (26)
Clonality
Polyclonal
Conjugate This MERTK antibody is un-conjugated
(12), (11), (8), (7), (6), (5), (5), (5), (4), (4), (4), (4), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(128), (95), (68), (41), (29), (20), (16), (15), (13), (13), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-MERTK Antibody

Target Details MERTK Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA
Isotype IgG

Target Details MERTK

Product Details anti-MERTK Antibody Application Details Handling Images back to top
Antigen
Alternative Name Mer (MERTK Antibody Abstract)
Background Gene Symbol: MERTK
Gene ID 10461
Pathways RTK Signaling

Application Details

Product Details anti-MERTK Antibody Target Details MERTK Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MERTK Antibody Target Details MERTK Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MERTK Antibody Target Details MERTK Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-MERTK antibody (C-Mer Proto-Oncogene Tyrosine Kinase) (ABIN5078050) Immunocytochemistry/Immunofluorescence: Mer Antibody - Staining of human cell line U...