You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Neuregulin 2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Neuregulin 2 Antibody (supplied by: Log in to see )

Antigen
Neuregulin 2 (NRG2) Antibodies
  • Don1
  • DON1
  • HRG2
  • NRG2
  • Ntak
  • NTAK
  • NTAK_alpha2a
Reactivity
Human
41
5
3
Host
Rabbit
36
6
Clonality
Polyclonal
Conjugate
This Neuregulin 2 antibody is un-conjugated
4
3
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
28
19
18
4
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4338711
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.00089407334 ABIN1882105 IHC (p) Rabbit AA 358-389, C-Term Log in to see Polyclonal 5
0.00089407334 ABIN3187750 ELISA IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal
0.00089407334 ABIN1175592 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 101-211 Log in to see Polyclonal

Top referenced anti-Neuregulin 2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-Neuregulin 2 Antibodies

Application / Reactivity Human
ELISA 27 Antibodies
ELISA (Capture) 1 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunohistochemistry (IHC) 20 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4 Antibodies
Western Blotting (WB) 18 Antibodies

General

Antigen Neuregulin 2 (NRG2) Antibodies
Reactivity Human
(41), (5), (3)
Host Rabbit
(36), (6)
Clonality
Polyclonal
Conjugate This Neuregulin 2 antibody is un-conjugated
(4), (3), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(28), (19), (18), (4), (2), (2), (1)
Supplier Log in to see

Product Details anti-Neuregulin 2 Antibody

Target Details Neuregulin 2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMK
Isotype IgG

Target Details Neuregulin 2

Product Details anti-Neuregulin 2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Neuregulin-2 (NRG2 Antibody Abstract)
Background Gene Symbol: NRG2
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-Neuregulin 2 Antibody Target Details Neuregulin 2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Neuregulin 2 Antibody Target Details Neuregulin 2 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Neuregulin 2 Antibody Target Details Neuregulin 2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neuregulin 2 antibody (NRG2) (ABIN4338711) Immunohistochemistry-Paraffin: Neuregulin-2 Antibody [NBP1-87971] - Staining of human...
Western Blotting (WB) image for anti-Neuregulin 2 antibody (NRG2) (ABIN4338711) Western Blot: Neuregulin-2 Antibody [NBP1-87971] - Lane 1: Marker [kDa] 250, 130, 95,...