anti-Human Neuregulin 4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Neuregulin 4 Antibody (supplied by: Log in to see )

Neuregulin 4 (NRG4) Antibodies
  • HRG4
  • AI552600
  • neuregulin 4
  • NRG4
  • LOC100226066
  • Nrg4
  • LOC100347220
This Neuregulin 4 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4340691
Contact our Customer Service for availability and price in your country.


Antigen Neuregulin 4 (NRG4) Antibodies
Reactivity Human
(36), (14), (9), (3)
Host Rabbit
(37), (1)
Conjugate This Neuregulin 4 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(29), (22), (20), (2), (2), (2)
Supplier Log in to see

Product Details anti-Neuregulin 4 Antibody

Target Details Neuregulin 4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK
Isotype IgG

Target Details Neuregulin 4

Product Details anti-Neuregulin 4 Antibody Application Details Handling Images back to top
Alternative Name NRG4 (NRG4 Antibody Abstract)
Background Gene Symbol: NRG4
Gene ID 145957
Research Area Signaling, Tyrosine Kinases
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-Neuregulin 4 Antibody Target Details Neuregulin 4 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Neuregulin 4 Antibody Target Details Neuregulin 4 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-Neuregulin 4 Antibody Target Details Neuregulin 4 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Neuregulin 4 (NRG4) antibody (ABIN4340691) Immunohistochemistry: NRG4 Antibody [NBP1-81709] - Staining of human kidney shows mod...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Neuregulin 4 (NRG4) antibody (ABIN4340691) Immunohistochemistry-Paraffin: NRG4 Antibody - Staining of human cerebellum shows st...