anti-Human NFATC3 antibody for Immunocytochemistry

Recommended NFATC3 Antibody (supplied by: Log in to see )

Antigen
Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 3 (NFATC3) Antibodies
  • NFATC3
  • NFATx
  • nf-at
  • nfat4
  • nfatx
  • C80703
  • D8Ertd281e
  • NFAT4
  • NFATX
  • nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
  • nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 3
  • NFATC3
  • nfatc3
  • Nfatc3
Reactivity
Human
53
28
5
4
4
3
2
1
1
1
1
1
Host
Rabbit
35
15
3
1
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
42
18
15
14
6
5
3
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5078353
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2743218 ICC IF IHC (p) WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2858192 ICC IF WB Rabbit pSer165 Log in to see Polyclonal

Similar anti-NFATC3 Antibodies

Application / Reactivity Human
Dot Blot (DB) 3 Antibodies
ELISA 18 Antibodies
ELISA (Capture) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 16 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 3 Antibodies
Immunohistochemistry (IHC) 14 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antibodies
Immunoprecipitation (IP) 6 Antibodies
Western Blotting (WB) 41 Antibodies

General

Antigen Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 3 (NFATC3) Antibodies
Reactivity Human
(53), (28), (5), (4), (4), (3), (2), (1), (1), (1), (1), (1)
Host Rabbit
(35), (15), (3), (1)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(42), (18), (15), (14), (6), (5), (3), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-NFATC3 Antibody

Target Details NFATC3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SHLPQLQCRDESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSGLVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQP
Isotype IgG

Target Details NFATC3

Product Details anti-NFATC3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name NFATC3/NFAT4 (NFATC3 Antibody Abstract)
Background Gene Symbol: NFATC3
Gene ID 4775
Pathways RTK Signaling, WNT Signaling, Fc-epsilon Receptor Signaling Pathway, Chromatin Binding

Application Details

Product Details anti-NFATC3 Antibody Target Details NFATC3 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-NFATC3 Antibody Target Details NFATC3 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-NFATC3 Antibody Target Details NFATC3 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-NFATC3 antibody (Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 3) (ABIN5078353) Immunocytochemistry/Immunofluorescence: NFATC3/NFAT4 Antibody - Staining of human ce...