You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PDGFBB antibody for Western Blotting

Recommended PDGFBB Antibody (supplied by: Log in to see )

Antigen
Platelet Derived Growth Factor BB (PDGFBB) Antibodies
  • c-sis
  • PDGF-2
  • PDGF2
  • SIS
  • SSV
Epitope
AA 82-190
8
6
5
1
1
1
Reactivity
Human
34
8
7
Host
Rabbit
43
3
1
Clonality
Polyclonal
Conjugate
This PDGFBB antibody is un-conjugated
6
4
1
1
1
1
Application
Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
31
30
10
8
4
3
3
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN1860159
$ 345.40
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.13433187 ABIN3201470 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG AA 82-190 Log in to see
0.0011739905 ABIN411554 WB Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2743554 WB Rabbit IgG AA 82-190 Log in to see Polyclonal
0.0011739905 ABIN2583006 WB Rabbit Internal Region Log in to see Polyclonal
0.0011739905 ABIN2967393 WB Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN1982271 Neut WB Sheep IgG AA 82-190 Log in to see Polyclonal
0.0011739905 ABIN2963762 IHC (p) WB Rabbit AA 21-70 Log in to see Polyclonal
0.0011739905 ABIN1003016 Inhibition ELISA WB Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN636707 Inhibition ELISA WB Rabbit Log in to see Polyclonal
0.0011739905 ABIN640559 Func ELISA WB Rabbit IgG Log in to see
0.0011739905 ABIN2337056 ELISA WB Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2337057 ELISA WB Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2337059 ELISA WB Biotin Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2337052 Neut IHC ELISA WB FITC Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2337054 Neut IHC ELISA WB PE Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2337053 Neut IHC ELISA WB HRP Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2337062 Neut IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2337063 Neut IHC ELISA WB APC Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2337064 Neut IHC ELISA WB Biotin Rabbit IgG Log in to see Polyclonal
0.0011739905 ABIN2337065 WB Mouse IgG1 Log in to see 1-A-7

Similar anti-PDGFBB Antibodies

Application / Reactivity Human
Blocking Antibody (Inhibition) 2 Antibodies
ELISA 23 Antibodies
Functional Studies (Func) 2 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunohistochemistry (IHC) 9 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 3 Antibodies
Neutralization (Neut) 8 Antibodies
Western Blotting (WB) 25 Antibodies

General

Antigen Platelet Derived Growth Factor BB (PDGFBB) Antibodies
Epitope AA 82-190
(8), (6), (5), (1), (1), (1)
Reactivity Human
(34), (8), (7)
Host Rabbit
(43), (3), (1)
Clonality
Polyclonal
Conjugate This PDGFBB antibody is un-conjugated
(6), (4), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
(31), (30), (10), (8), (4), (3), (3), (2), (2), (1)
Supplier Log in to see

Product Details anti-PDGFBB Antibody

Target Details PDGFBB Application Details Handling Images
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-SLGSLTIAE PAMIAECKTR TEVFEISRRL IDRTNANFLV WPPCVEVQRC SGCCNNRNVQ CRPTQVQLRP VQVRKIEIVR KKPIFKKATV TLEDHLACKC ETVAAARPVT
Specificity It has been selected for its ability to recognize PDGFBB in immunohistochemical staining and Western blotting.
Purification Affinity Chromatography
Immunogen Recombinant PDGFBB expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against PDGFBB.
Isotype IgG

Target Details PDGFBB

Product Details anti-PDGFBB Antibody Application Details Handling Images back to top
Antigen
Alternative Name Platelet Derived Growth Factor BB (PDGFBB Antibody Abstract)
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-PDGFBB Antibody Target Details PDGFBB Handling Images back to top
Application Notes Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user.
Comment

Content: The quality control contains recombinant PDGFBB (Ser82~Thr190) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2% SDS, 200 mM NaCl, 50% glycerol,BPB 0.01%, NaN3 0.02%.

Restrictions For Research Use only

Handling

Product Details anti-PDGFBB Antibody Target Details PDGFBB Application Details Images back to top
Format Liquid
Concentration 200 µg/mL
Buffer Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Preservative Sodium azide
Precaution of Use WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
Handling Advice Avoid repeated freeze/thaw cycles
Storage 4 °C
Storage Comment Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
Expiry Date 12 months

Images

Product Details anti-PDGFBB Antibody Target Details PDGFBB Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-PDGFBB antibody (Platelet Derived Growth Factor BB) (AA 82-190) (ABIN1860159) anti-Platelet Derived Growth Factor BB (PDGFBB) (AA 82-190) antibody