You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PDGFC antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PDGFC Antibody (supplied by: Log in to see )

Platelet-Derived Growth Factor C (PDGFC) Antibodies
  • 1110064L01Rik
  • AI647969
  • PDGF-C
  • platelet derived growth factor C
  • platelet-derived growth factor C-like
  • platelet-derived growth factor, C polypeptide
  • Pdgfc
  • LOC100350272
  • LOC100515267
This PDGFC antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344542
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN650654 IHC (p) WB Rabbit Ig AA 74-103, N-Term Log in to see Polyclonal 1
1 ABIN714566 IF (p) IHC (p) WB Rabbit IgG AA 240-290 Log in to see Polyclonal 1
1 ABIN714575 IHC (p) WB HRP Rabbit IgG AA 240-290 Log in to see Polyclonal
1 ABIN714568 IHC (p) WB Biotin Rabbit IgG AA 240-290 Log in to see Polyclonal
1 ABIN4902108 ELISA IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN188196 IHC (p) ELISA WB Goat AA 230-345 Log in to see Polyclonal 2

Top referenced anti-PDGFC antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PDGFC Antibodies

Application / Reactivity Human
Blocking Peptide (BP) 1 Antibodies
ELISA 24 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 19 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Neutralization (Neut) 2 Antibodies
Western Blotting (WB) 28 Antibodies


Antigen Platelet-Derived Growth Factor C (PDGFC) Antibodies
Reactivity Human
(48), (35), (24), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(47), (4), (2), (1)
Conjugate This PDGFC antibody is un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(34), (25), (21), (13), (6), (3), (3), (2), (2), (1)
Supplier Log in to see

Product Details anti-PDGFC Antibody

Target Details PDGFC Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA
Isotype IgG

Target Details PDGFC

Product Details anti-PDGFC Antibody Application Details Handling Images back to top
Alternative Name PDGF-C (PDGFC Antibody Abstract)
Background Gene Symbol: PDGFC
Gene ID 56034
Pathways RTK Signaling, Platelet-derived growth Factor Receptor Signaling

Application Details

Product Details anti-PDGFC Antibody Target Details PDGFC Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PDGFC Antibody Target Details PDGFC Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-PDGFC Antibody Target Details PDGFC Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-PDGFC antibody (Platelet-Derived Growth Factor C) (ABIN4344542) Immunocytochemistry/Immunofluorescence: PDGFC Antibody [NBP1-83935] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PDGFC antibody (Platelet-Derived Growth Factor C) (ABIN4344542) Immunohistochemistry-Paraffin: PDGFC Antibody [NBP1-83935] - Staining of human colon ...